SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434391946|ref|YP_007126893.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434391946|ref|YP_007126893.1|
Domain Number 1 Region: 104-317
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 4.42e-56
Family BC ATP-binding domain-like 0.00000702
Further Details:      
 
Domain Number 2 Region: 1-102
Classification Level Classification E-value
Superfamily PreATP-grasp domain 1.58e-36
Family BC N-terminal domain-like 0.0000357
Further Details:      
 
Domain Number 3 Region: 328-420
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 4.71e-30
Family BC C-terminal domain-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|434391946|ref|YP_007126893.1|
Sequence length 427
Comment phosphoribosylamine--glycine ligase [Gloeocapsa sp. PCC 7428]
Sequence
MKVLVVGSGGREHAIAWKLLRSPQVEQVFCAPGNGGTAILDRCQNLPLSVEDFASMGEFA
RSHNIDLVVVGPEVPLALGITDNLQRLGIKVFGPTRAGAQIEASKAWAKALMQEAKIPTA
KAAVFHHAAAAKDYVKAQGAPIVVKADGLAAGKGVTVAETVAQAHSAIDAIFQGQFGAGE
FVVIEECLVGQEASVLALTDGLTIRPLLPAQDHKRIGEGDTGENTGGMGVYAPAPIVTPE
LIAEIEAKVLQPAIATLKKKGIDYRGVLYAGLMIAPNGDFKVLEFNCRFGDPETQAILPL
LETPLEELLLACVEQRLAQMPPIAWKSGASACVVIAAGGYPGSYEKGKVISGIDFAEALG
ANVFHAGTKLLSNLVTDGGRVLGVTGIGENFEQAIALAYQAVNCIQFEKMYYRRDIGYRV
KSKAVNF
Download sequence
Identical sequences K9XB59
WP_015187609.1.9315 gi|434391946|ref|YP_007126893.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]