SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434391982|ref|YP_007126929.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434391982|ref|YP_007126929.1|
Domain Number 1 Region: 21-262
Classification Level Classification E-value
Superfamily PLP-binding barrel 3.49e-69
Family Alanine racemase-like, N-terminal domain 0.000015
Further Details:      
 
Domain Number 2 Region: 256-389
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 5.23e-49
Family Alanine racemase 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|434391982|ref|YP_007126929.1|
Sequence length 390
Comment alanine racemase [Gloeocapsa sp. PCC 7428]
Sequence
MTLSRQQPIATMRCDRAWVEISLGALAHNIHQLQSLLSAKTHLMAVVKADAYGHGAVTVA
ETVLQAGASWLGVATVPEGIELREAGISAPILILGATHTPEQIKAIAHWQLQPTVCSFKQ
ALVFAETLKTTNQVLPVHLKLDTGMSRLGPSWQQAVEFVQLIQGLPNLKIASIYSHLATA
ESSDQTILRQQQQNFEQAIAQIKRSNPQLFQHKQIRPALHLANSAATLTAPDLHYDMVRV
GLAMYGLYPAVHLAAIDLKPVMQVKARITQVKKIPAGTGVSYGHKFVSDRAMQIAVVGIG
YADGVPRNLSNQMTVLVRGQQVPQIGAITMDQLMLDITAIADVREGEVVTLLGEDGSKKI
SADDWANQLSTISWEILCSFKHRLPRVAVP
Download sequence
Identical sequences K9XCF3
WP_015187645.1.9315 gi|434391982|ref|YP_007126929.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]