SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434392228|ref|YP_007127175.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434392228|ref|YP_007127175.1|
Domain Number 1 Region: 97-466
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.07e-94
Family Amylase, catalytic domain 0.000022
Further Details:      
 
Domain Number 2 Region: 7-74
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000233
Family AMPK-beta glycogen binding domain-like 0.015
Further Details:      
 
Domain Number 3 Region: 469-549
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.0000000008
Family alpha-Amylases, C-terminal beta-sheet domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|434392228|ref|YP_007127175.1|
Sequence length 551
Comment 1,4-alpha-glucan branching enzyme [Gloeocapsa sp. PCC 7428]
Sequence
MAAPIEFELFAPYIKGAALIGDFSNWEDIPMQKGEDGYFRTQVELEDGSYQYKFRVQSKS
WFFEPDQWVEVVDPYAVDIDNPTQNGVVRIKDGQRIVDTYVWQHDDKPLPADHELVIYEL
HVGDFSGGEDDPYARGKYKHVVEKLDYLCELGVNAIELMPVKEYPGDHSWGYNPRHFFAT
ESSYGPTEGLKHLIDECHARGIRVIMDGIYNHSEASAPLTQIDHDYWYHHAPRDPDNNWG
PEFNYEHYDENLETYPARRFIGDNVRFWIQEYHTDGIRFDAARQIANYDFMHWIVQEAKK
TADMKPFYTVAEHIPETPSITNADGPMDGCWHDSFYHCVLEHICGDTFDLERLKDVIDCK
RQGFMGTVNVVNYLTNHDHNHLMVELGDREIFDEEAFKRIKLGVAILMTAIGVPLVWMGE
EFGEYKPKTPDSAKIDWTLLGNDLNRGLFEYYKGMIGLRKQNHALYTENIDFFHENPEAK
VLAYTRWNEEGSRVVVIANFSENFLGGYHVPNFPAAGKWHEWTGDYDIESGDDGMMLDIG
GYEAKVFVWQQ
Download sequence
Identical sequences K9XBJ1
WP_015187891.1.9315 gi|434392228|ref|YP_007127175.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]