SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434392470|ref|YP_007127417.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434392470|ref|YP_007127417.1|
Domain Number 1 Region: 2-118
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 8.42e-26
Family DNA-binding N-terminal domain of transcription activators 0.00091
Further Details:      
 
Domain Number 2 Region: 118-266
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 1.41e-20
Family Multidrug-binding domain of transcription activator BmrR 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|434392470|ref|YP_007127417.1|
Sequence length 269
Comment transcriptional activator ligand binding domain protein [Gloeocapsa sp. PCC 7428]
Sequence
MLKIGDFSKLSHVSIKALRLYDQMGLLKPVHVDEFTGYRYYAAHQLPRLNRILALKDLGF
SLEQIAKLLNEISPAQIQGMLQLKHAELQRLVAEEQARLQRVAARLQQMEEDNMPDYDVV
VKTVTPIKVAAIREIIPSFHAVAGLYDELLEYLRLCQGVKESSYCAGIWHDSAYKDTDID
WEVAIAVEEVYGSDRIKVYELPRVEMACVVHNGSYNTISRAYAALPAWIEASGYKITGSN
REVYIVGGNQQDDESYVTEVQFPVKKLDS
Download sequence
Identical sequences K9XF02
gi|434392470|ref|YP_007127417.1| WP_015188131.1.9315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]