SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|434392584|ref|YP_007127531.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434392584|ref|YP_007127531.1|
Domain Number 1 Region: 16-203
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 1.96e-36
Family Isochorismatase-like hydrolases 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|434392584|ref|YP_007127531.1|
Sequence length 219
Comment isochorismatase hydrolase [Gloeocapsa sp. PCC 7428]
Sequence
MQSAFGLSIPMTLEDVCHPQKMALLVYDMQVGIAQQLFNAVEFIQQVKQVVDVARSHQMR
VFFSRHTTLPKEIAGVSQLKGAMALQRVTTVAEVQPNFLPDSAAHAVVPDLAPLPSEVAF
DKLTMSAFVGSYLDLALRDARIEAIAIVGAVLEFGIEPTVRHAADLGYVPVLISDACYSF
SEQNRTTSLAALQSTSLIADINTFHTTLDRVHQNEADAI
Download sequence
Identical sequences K9XE77
WP_015188245.1.9315 gi|434392584|ref|YP_007127531.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]