SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434392607|ref|YP_007127554.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434392607|ref|YP_007127554.1|
Domain Number 1 Region: 7-187
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.87e-36
Family Pyruvate oxidase and decarboxylase Pyr module 0.0028
Further Details:      
 
Domain Number 2 Region: 402-572
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.02e-20
Family Pyruvate oxidase and decarboxylase PP module 0.021
Further Details:      
 
Weak hits

Sequence:  gi|434392607|ref|YP_007127554.1|
Domain Number - Region: 227-389
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 0.000687
Family Pyruvate oxidase and decarboxylase, middle domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|434392607|ref|YP_007127554.1|
Sequence length 590
Comment 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase [Gloeocapsa sp. PCC 7428]
Sequence
MIDWRNTNSVWGSILAETFGRLGLKTAVICPGSRSTPLAIAFAQTHGVEAIPILDERSAA
FFALGIARQTGHPVVLVCTSGTAAANFYPAIIEARESRVPLIVLTADRPPELRDCHSGQT
IDQVKLYGTYASWYAELALPSLEIEMLAYLRQTLIYAWERSRYPVAGVVHLNIPFRDPLA
PIPDTATEILRSQFNPQDFFNTIQLPINASCYNGGHLRNALAPHYPLPIPHPNEWKQGDR
GIIIAGLAQPQQPREYCGAIAQLAKTLKFPVLAEALSPVRNYADLNPYLISTYDLIVRNP
QLAQQLQPKIVIQIGELPTSKDLRQWLSVTQPQRWIVDPCDRNLDPLHGKTIHLRTTVEQ
LAQAIEPKAPTAYLQLWCDAEAKVRSECDRTMAEIDHLFEGKAAWLLSQVLPPKTPLFVA
NSMPVRDMEFFWKPSNSNIRPFFNRGANGIDGTLSTALGVAYRNQSSVLLTGDLALLHDT
NGFLINNKFIGHLTIVLINNNGGGIFEMLPISKFEPPFEEFFATPQNIDFAQLCATYNVE
HELIQSWEQLQQKLNPLPTTGIRVLELQTDRKADAKWRKDNLGKLATEHL
Download sequence
Identical sequences K9XE65
gi|434392607|ref|YP_007127554.1| WP_015188268.1.9315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]