SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434392727|ref|YP_007127674.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434392727|ref|YP_007127674.1|
Domain Number 1 Region: 19-165
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 3.94e-19
Family Potassium channel NAD-binding domain 0.02
Further Details:      
 
Domain Number 2 Region: 380-521
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.0000000000000201
Family Potassium channel NAD-binding domain 0.031
Further Details:      
 
Domain Number 3 Region: 269-404
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000518
Family Voltage-gated potassium channels 0.0067
Further Details:      
 
Domain Number 4 Region: 512-592
Classification Level Classification E-value
Superfamily TrkA C-terminal domain-like 0.0000068
Family TrkA C-terminal domain-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|434392727|ref|YP_007127674.1|
Sequence length 675
Comment TrkA-N domain protein [Gloeocapsa sp. PCC 7428]
Sequence
MLPSSGSTKTNKPPPQLTRFLVCGLGSLGQHCVAVLKDYGVAVSAIDLVLPQNWEIPDLP
SLLDDLAIGDCRQTSILEQVKIHECRSVLLVTSDERGNTEAAFAARLLNPHIRLILRSDK
QNLNQLLSENLGNFVAFEPSQLSAAAFALAALGDQTLGYFNLEGQLLQVIKYQIKPGDRW
CDRWWVYGLNTRNRRILSHTTNTAQLPKQFYEWEPEATVKAGDTIVYIEVAQLSSTAQPA
KTHSTKQLPHAVSRTLTRHLQQQFSQFWQWAYQYQTRRVAVICGATVLTLLVCGTILFRW
EYPEIDLQAAFNATATLLLGGYGDLFGDIKPETPLSLGLQVFSLILALAGTAFIGVLYAL
LIEMLLTSRFHFRSRPPLPQQDHIVVIGLGRLSQRVATLLQEFKQSIVGISHAELDPGIL
PQMPLVVDNIANAFTKVHLENAKSAIVITEDDLENLEVGLMLHALNPQLGIVIHCYDQHF
SDRVARLFPYAQVLCASALSAEVFAAAAFGENVLSLFHFNGTTVLVTEYIIAAGDTLNGL
MLSEVAYGYGVVPLLYHHKHESAKLMPAYETRLYVGDRLVVLATSHSLQRIERGELAPRQ
WQLRVEKALYQDAIFDGANAIALISGCRLAIARQLMQNLPATLPQALYYHQAQHLVRELS
KVQVNAHLIKIVNSI
Download sequence
Identical sequences K9XEI5
WP_015188388.1.9315 gi|434392727|ref|YP_007127674.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]