SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|434392982|ref|YP_007127929.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434392982|ref|YP_007127929.1|
Domain Number 1 Region: 4-69
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.00000000000000658
Family 7-Fe ferredoxin 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|434392982|ref|YP_007127929.1|
Sequence length 74
Comment 4Fe-4S ferredoxin iron-sulfur binding domain protein [Gloeocapsa sp. PCC 7428]
Sequence
MPHTIVTETCEGVADCVDACPVACIHPGPGKNMKGTEWFWIDFATCIDCGICIQVCPVEG
AIVPEERPELQKNP
Download sequence
Identical sequences A0A1U7HZU4 K9XF95
WP_015188641.1.78850 WP_015188641.1.9315 gi|434392982|ref|YP_007127929.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]