SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434393070|ref|YP_007128017.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434393070|ref|YP_007128017.1|
Domain Number 1 Region: 3-310
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 7.78e-110
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.00000132
Further Details:      
 
Domain Number 2 Region: 312-477
Classification Level Classification E-value
Superfamily An anticodon-binding domain of class I aminoacyl-tRNA synthetases 9.16e-37
Family C-terminal domain of glutamyl-tRNA synthetase (GluRS) 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|434393070|ref|YP_007128017.1|
Sequence length 482
Comment glutamyl-tRNA synthetase ;glutamate--tRNA(Gln) ligase [Gloeocapsa sp. PCC 7428]
Sequence
MTVRVRIAPSPTGNLHIGTARTAVFNWLFARHHGGQFILRIEDTDTERSREEYTQNILDG
LTWLGLNWDEGPIFQSHRLDVYRQRVQDLLDKGLAYYCYCSEEELDAMREAQKARNEAPR
YDNRHRNLTPEQQAAFAAEGRRPVIRFKIEDDREIVWDDMVRGHMSWRGSDLGGDMVIAR
AAQAGDIGQPLYNFAVVVDDMDMQITHVIRGEDHIANTAKQILLYEAYEATVPEFAHTPL
ILNAEGRKLSKRDGVTSIFDFKEMGFVAEAMVNYMTLLGWSPPDSTQELFTLEEVAQQFG
FERVNKAGAKFDWAKLDWINSQYLHAMPAKKLTDLLIPYWQAAGYEFDPISDRVWLEKIA
SVIGPSLTRLKDAVEMSWLYFTNSLTYSDDATHQLQQEGSKAVLEGVLAALNNGTELTEA
SSQEIIKHVVKEKNVKKGLVMRSLRAALTGDMQGPDLIQSWVILHQRQFDKPRLESAIAT
VH
Download sequence
Identical sequences K9XGR9
WP_015188729.1.9315 gi|434393070|ref|YP_007128017.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]