SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434393170|ref|YP_007128117.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434393170|ref|YP_007128117.1|
Domain Number 1 Region: 162-288
Classification Level Classification E-value
Superfamily PIN domain-like 6.73e-24
Family PIN domain 0.0069
Further Details:      
 
Weak hits

Sequence:  gi|434393170|ref|YP_007128117.1|
Domain Number - Region: 29-94
Classification Level Classification E-value
Superfamily Clc chloride channel 0.0523
Family Clc chloride channel 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|434393170|ref|YP_007128117.1|
Sequence length 359
Comment PilT protein domain protein [Gloeocapsa sp. PCC 7428]
Sequence
MLDAIIIISFIVAGAGIGYYSIELLPENVQQQVTNVEALRLVFAAFAALIGGAGGLSFQI
SYRRIEKQVREMPIEVILTRAIGLVLGLLIANLMLAPLFLLPIPADFSFIKPLIAVLGSI
MFAFSGVSLADTHGPALLRLINFNNVESVLLAEGTLKAAATKVVDTSCIIDGRLETLLET
GFLEGQILVPQFVLQELQQLADGAKDQKRVRGRRGLEILNRLKETYADRILIHPVDYDDV
PTVDAKLVRFAQEISGTLVTNDYNLSKVASVQKVPVLNINDLVQAVRPTYLPGDSIDLKV
LKEGKEPSQGVGYLEDGTMVVVEEGSSYVGGEVRVIVTSALQTTAGRMIFAKPQASALA
Download sequence
Identical sequences K9XH32
gi|434393170|ref|YP_007128117.1| WP_015188829.1.9315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]