SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434393222|ref|YP_007128169.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434393222|ref|YP_007128169.1|
Domain Number 1 Region: 11-65
Classification Level Classification E-value
Superfamily Rubredoxin-like 2.36e-20
Family Rubredoxin 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|434393222|ref|YP_007128169.1|
Sequence length 111
Comment Rubredoxin-type Fe(Cys)4 protein [Gloeocapsa sp. PCC 7428]
Sequence
MSESVVESQGLDRYECRVCGYVYEPTKGDSKEEVPAGTPFTELASSWRCPVCGARTSQFE
NIGPTGKASGFESNLGYGIGVNKLTPAQKNLLIFGGLALGFLLFMSLYGLK
Download sequence
Identical sequences A0A1U7HVQ5 K9XFX6
gi|434393222|ref|YP_007128169.1| WP_015188881.1.78850 WP_015188881.1.9315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]