SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434393421|ref|YP_007128368.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434393421|ref|YP_007128368.1|
Domain Number 1 Region: 57-323
Classification Level Classification E-value
Superfamily PLP-binding barrel 4.32e-78
Family Alanine racemase-like, N-terminal domain 0.0000101
Further Details:      
 
Domain Number 2 Region: 297-457
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 7.12e-51
Family Eukaryotic ODC-like 0.0000343
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|434393421|ref|YP_007128368.1|
Sequence length 464
Comment diaminopimelate decarboxylase [Gloeocapsa sp. PCC 7428]
Sequence
MVSTHPAGVQSGRQYLANSTGAVSPNQQLLPLSARINNSDRLEIGGCDVTTLVQQFGSPL
YIVDEDTLRTACRQYREAFQKYYPGSSQVLYASKAWSCLAVCAIAHQEGLGIDVVSGGEL
YTALQAGVSPDKLYLHGNNKSLEELKLAIDSGCTIVVDNWYELQTLGNWSSSIDHPIRIM
LRLTPGIECHTHEYIRTGHLDSKFGFDPNELDKVFAFVSQHSALNCVGLHAHIGSQIFEQ
QPHRDLAGVMVQWLDKASGYGLHIEELNVGGGLGIRYTEADDPPSIEAWVKGVCEAIKDA
CAAQQLALPKLLCEPGRSLIGAACVTAYTVGASKTIPGIRTYVAVDGGMSDNPRPITYQS
VYRAVVANKMSAPATQTVTIAGKHCESGDILIKEATLPPSQPGDILVVLATGAYNYSMAS
NYNRLARPAAVIVKDGEANLILRRETYQDLIRQDCLPARLSTEV
Download sequence
Identical sequences K9XFE4
WP_015189080.1.9315 gi|434393421|ref|YP_007128368.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]