SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434393473|ref|YP_007128420.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434393473|ref|YP_007128420.1|
Domain Number 1 Region: 1-308
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 4.69e-75
Family Cytidylytransferase 0.0035
Further Details:      
 
Domain Number 2 Region: 245-430
Classification Level Classification E-value
Superfamily Trimeric LpxA-like enzymes 3.06e-30
Family gamma-carbonic anhydrase-like 0.037
Further Details:      
 
Domain Number 3 Region: 636-743
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 2.63e-17
Family Phosphoglucomutase, first 3 domains 0.01
Further Details:      
 
Domain Number 4 Region: 371-557
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 0.000000000000647
Family Phosphoglucomutase, first 3 domains 0.0054
Further Details:      
 
Domain Number 5 Region: 748-834
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 0.00000000000296
Family Phosphoglucomutase, C-terminal domain 0.0099
Further Details:      
 
Domain Number 6 Region: 531-632
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 0.00000000667
Family Phosphoglucomutase, first 3 domains 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|434393473|ref|YP_007128420.1|
Sequence length 852
Comment Mannose-1-phosphate guanylyltransferase, Phosphoglucosamine mutase [Gloeocapsa sp. PCC 7428]
Sequence
MRAVLMAGGSGTRLRPLTCDLPKPMVPILNRPIAEHIINLLKRHQITEVIATLHYLPEVI
RDYFQDGTDFGVDLIYAVEEDQPLGTAGCVKNIAELLNETFLVISGDSVTDFDLTAAIEF
HKRKQAKATLVLTRVPNPIEFGVVITDEDYRIRRFLEKPSTSEIFSDTVNTGIYILEPSV
LEYLPANQESDFSKDLFPLLLEKGEPMYGYIAQGYWCDVGHLDAYRESQYDGLFGKVKLD
FAYTETKPGLWEGQNTYIDPSVEICPPVLIGHNCRIGPRVRIDAGTVIGDNVTIGADADL
KRPIIWNGGIVGEDAELRACVIGRGTRVDRRAQVLEGAVVGSLSTVGEEAQISPNVRVWP
SKQIESGAILNINLIWGQTAQRNLFGQRGVTGLANIDITPEFAVKLGAAYGSTLKPGSQV
MISRDQRSISRMATRSLIAGLMSVGVNIQNLDATAVPMSRTVVPTLGVAGGIHVRLHPDR
PDYLLIEFIDNKGVNISKALEKKIEGAYFKEDFRRVQIHEIGNVVYPIQMIDTYCNAFEK
NLNVEAIRHSNSKVVIDYTYAVSGAVLPQLLAKFGCDAVVLNASLKQTAVSSVEKEALLQ
QLGHVVEALRATFGVQVSANGEQLILVDKLGTPIRGEMLTALMVNMILTAHPRGTVVVPI
HTSSAVEQIARRHDGKVIRTKASPTALMEASLPSANPNVVLAGSGDMGFIFPQLHPGFDA
MFCIAKVIEMLTVQERSLASIRDDDLPQVSHRSYTVRCPWTVKGALMRHLVETHNEENLE
LVDGVKIRFEDDNWILILPDAGEPLVHLFANSNDRNWVDESLREYRTRVQSFIEQQQGVE
AYSNSPQQSIVS
Download sequence
Identical sequences K9XF55
gi|434393473|ref|YP_007128420.1| WP_015189132.1.9315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]