SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434393477|ref|YP_007128424.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434393477|ref|YP_007128424.1|
Domain Number 1 Region: 204-400
Classification Level Classification E-value
Superfamily PheT/TilS domain 4.71e-61
Family B3/B4 domain of PheRS, PheT 0.00000557
Further Details:      
 
Domain Number 2 Region: 35-200
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.14e-46
Family Myf domain 0.0015
Further Details:      
 
Domain Number 3 Region: 490-703
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 5.47e-44
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000856
Further Details:      
 
Domain Number 4 Region: 714-813
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 1.44e-30
Family Anticodon-binding domain of PheRS 0.00046
Further Details:      
 
Domain Number 5 Region: 415-497
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.000000000000385
Family Domains B1 and B5 of PheRS-beta, PheT 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|434393477|ref|YP_007128424.1|
Sequence length 814
Comment phenylalanyl-tRNA synthetase beta subunit [Gloeocapsa sp. PCC 7428]
Sequence
MRISLNWLQELVELTLSPEELAETLTMAGFEVEEIEDRRAWAKGVVVGKVLECDRHPNAD
KLSVTKVDVGTASPEPLNIVCGAPNVRAGIYVPVATVGTYLPKIDVKIKAAKLRGVRSEG
MICSLAELGLAKESAGIHIFEQELELGSDVRPLLGLDDVILDLTATANRADALSMVGVAR
EVAAITGKTVQLPEAPEISISDTQKNLTLKISQSQACPAYIGTAIESVKIAPSPAWLQQR
LQAAGTRPINNVVDITNYILLEWGQPLHAFDRDRLLAVSGTQSDLTIGVRFAHGETLKTL
DGQMRTLSSQALLITAHDEPVALAGVMGGEATEVHEGTQNLVLEAALFDPVAIRRSARSQ
GLRTEASARYERGINAAELELACRRAIMLIQELAGGVPVQQEFADARPEIGATSRSIELR
LDRVNQILGPIDLEDTTGELQPATIQQILTALGCQVKPSSEQQKVLTVTVPPYRHRDLER
EIDLIEEISRLYGYDRFCDTLPEKTEPGYLSLEQQLTRQFREAFRAAGLTELIHYSLVKP
GQDRQIVLTNPIFVEYSALRTDLISGLIDAFQYNLEQGNGSLNGFEIGRIFWQEEDGLLE
AEAIGGILGGDPTQGKWTSGGKERPLTWFEAKGILESVFQRLGLKVEYQPSHQDSRLHPG
RTASLWLQGNRLGDFGQVHPQLRQEKGLPDAVYAFQLDLDVILDYWDRDEVLVPKFRSYS
TYPPSPRDIAFFAHLDVSVAEIERAIALAAGELLESVELFDEYRGEHVPQGQRSLAFRLV
YRAQNRTLTDEDIEPVHQKVRKSLVEKFGVNLRS
Download sequence
Identical sequences K9XGN0
gi|434393477|ref|YP_007128424.1| WP_015189136.1.9315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]