SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434393483|ref|YP_007128430.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434393483|ref|YP_007128430.1|
Domain Number 1 Region: 3-64
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 2.56e-19
Family Ribosomal protein L33p 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|434393483|ref|YP_007128430.1|
Sequence length 64
Comment LSU ribosomal protein L33P [Gloeocapsa sp. PCC 7428]
Sequence
MAKSKGVRITVTLECTECRTNPDKRSPGVSRYTTMKNRRNTTARLELKKFCPNCNRHTVH
KEIK
Download sequence
Identical sequences A0A1U7HX39 K9XF68
gi|434393483|ref|YP_007128430.1| WP_015189142.1.78850 WP_015189142.1.9315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]