SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434393616|ref|YP_007128563.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434393616|ref|YP_007128563.1|
Domain Number 1 Region: 182-642
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.37e-122
Family Amylase, catalytic domain 0.00000000427
Further Details:      
 
Domain Number 2 Region: 650-752
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.32e-37
Family alpha-Amylases, C-terminal beta-sheet domain 0.00038
Further Details:      
 
Domain Number 3 Region: 15-116
Classification Level Classification E-value
Superfamily E set domains 9.8e-17
Family E-set domains of sugar-utilizing enzymes 0.012
Further Details:      
 
Domain Number 4 Region: 140-199
Classification Level Classification E-value
Superfamily E set domains 0.0000000168
Family E-set domains of sugar-utilizing enzymes 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|434393616|ref|YP_007128563.1|
Sequence length 763
Comment 1,4-alpha-glucan-branching enzyme [Gloeocapsa sp. PCC 7428]
Sequence
MSMTIAPEQVERIVWNQHDDPFEVLGSHPIEQDGKTVWVVRAYLPNASAAWVIRPEARIE
HQMHPVHHPHFFECTIDVSELANYQLKIKEGEHERVIYDPYAFRSPKLTDFDLHLFSEGN
HHRIYEKLGAHLTEVDGVKGVYFAVWAPNARNVSILGDFNSWDGRKHQMRKGVTGIWELF
IPEITVGDRYKYEIKNFDGHIYEKSDPYGFQQEVRPKTASIVADLEAYAWNDAEWMEQRR
HTDTLTQPISVYEVHLGSWLHAASAEPAKLPNGETEPVVPVSELQPGARFLTYRELAAKL
IPYVKDLGYTHVELLPIAEHPFDGSWGYQVTGYYACTSRYGSPEDFMYFIDQCHQNGIGV
IVDWVPGHFPKDGHGLAFFDGTHLYEHADPRKGEHKEWGTLVFNYSRHEVRNFLVANALF
WFDKYHIDGIRVDAVASMLYLDYCRKEGEWLPNQYGGRENIEAAEFLRQTNHVIFSYFPG
ILSIAEESTDWPMVSWPTYTGGLGFNLKWNMGWMHDMLDYFSMDPWFRQFHQNNITFSMW
YHHSENFMLALSHDEVVHGKSNIIGKMPGDRWQKFASVRCLFTYMFAHPGKKTLFMGMEF
GQWSEWNVWGDLEWHLLQYEPHQQLKRFMKDLNHLYRAEPALYTQDFGQAGFEWIDCSDN
RHSVVSFIRRGKDPEDFVIVVCNFTPQPHSHYRIGVPEFGFYTEIFNSDAREYGGSNMGN
LGGKWAEEWSYHNHSYSIDLCLPPLGVLILKLDGEKTAQALRK
Download sequence
Identical sequences K9XFX5
WP_015189275.1.9315 gi|434393616|ref|YP_007128563.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]