SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434393829|ref|YP_007128776.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434393829|ref|YP_007128776.1|
Domain Number 1 Region: 6-170
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 4.71e-40
Family Phosphoglucomutase, first 3 domains 0.0013
Further Details:      
 
Domain Number 2 Region: 255-385
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 4.32e-29
Family Phosphoglucomutase, first 3 domains 0.0012
Further Details:      
 
Domain Number 3 Region: 158-269
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.49e-23
Family Phosphoglucomutase, first 3 domains 0.0013
Further Details:      
 
Domain Number 4 Region: 388-474
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 1.09e-21
Family Phosphoglucomutase, C-terminal domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|434393829|ref|YP_007128776.1|
Sequence length 476
Comment Phosphoglucosamine mutase [Gloeocapsa sp. PCC 7428]
Sequence
MPVAGNAIKFGTDGWRGIIGDEFTFDNLSLVAPIAAKVLSQTYGDTGSNTVIVGYDRRFM
AEVFAQKAAKAVTEAGFDVLLSETYAPTPAFSLAAKQHNALGALVITASHNPGSYLGLKV
KGAFGGSVPPEVTREIEALLSEPLPTQTTGKISHFNPWQNYCETLRAKVDIEKIRACMMQ
GKLSVFADAMHGAASGGLSQILGVPIEEINSDRDPLFGGGAPEPLPRYLSRLFRLMRSHQ
RNAAEALAVGLVFDGDADRIAAVDGQGNFLSSQVLIPILIEHLAVERGLTGEIVKTVSGS
DLIPKVAALHQLSVYETPIGYKYIADRMLETHVLLGGEESGGIGYGTHIPERDALLSALY
VLEAIATSQTDLSDLYRQLQAKTDFTSAYDRIDLPLASMEVRSRLLAQLQNQPPSEIAGE
RVQNCLSIDGYKFRLADNSWLMIRFSGTEPVLRLYCEAPTMQQVQRTLAWAKQWAE
Download sequence
Identical sequences K9XHT7
WP_015189486.1.9315 gi|434393829|ref|YP_007128776.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]