SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434393943|ref|YP_007128890.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434393943|ref|YP_007128890.1|
Domain Number 1 Region: 1-158
Classification Level Classification E-value
Superfamily Glutamyl tRNA-reductase catalytic, N-terminal domain 3.14e-46
Family Glutamyl tRNA-reductase catalytic, N-terminal domain 0.00037
Further Details:      
 
Domain Number 2 Region: 319-422
Classification Level Classification E-value
Superfamily Glutamyl tRNA-reductase dimerization domain 4.71e-28
Family Glutamyl tRNA-reductase dimerization domain 0.0038
Further Details:      
 
Domain Number 3 Region: 160-316
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 7.62e-28
Family Aminoacid dehydrogenase-like, C-terminal domain 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|434393943|ref|YP_007128890.1|
Sequence length 428
Comment glutamyl-tRNA reductase [Gloeocapsa sp. PCC 7428]
Sequence
MNIAVVGLSHKTAPVEVREKLSIPESQTESAIAHLLTYPHIEEVAILSTCNRLEIYIVAR
ETQQGIQEVAQFLAEHSKLPASSLRQHLFIFLHEDAVMHLMRVAAGLDSLVLGEGQILAQ
VKQTHKLGQQYNGIKLILNKLFKQALTAGKRVRTETSIGTGAVSISSAAVELAQLKVQNL
AACRVMIIGAGKMSRLLVQHLIAKGAAQICIINRSRQRAEELANQFRQIDLQLHSMSEMM
SVMAMSDLVFTSTAATEPLLDRAKLEAALEPSRSLMLFDISVPRNVHADVNELSFVQAFN
VDDLKAVVAQNHESRRRMAMEAEKLLEEEVTAFEVWWRSLDTVTTISCLRDKVETIREQE
LEKALSRLGSEFAEKHQEVIEALTRGIVNKILHDPMVQLRSQQDIEARKRCMQTLQMLFN
LDVEEQFS
Download sequence
Identical sequences K9XGG2
WP_015189599.1.9315 gi|434393943|ref|YP_007128890.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]