SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|434394011|ref|YP_007128958.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434394011|ref|YP_007128958.1|
Domain Number 1 Region: 32-186
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 0.000000000000804
Family Hypothetical protein TT1808 (TTHA1514) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|434394011|ref|YP_007128958.1|
Sequence length 250
Comment protein of unknown function DUF820 [Gloeocapsa sp. PCC 7428]
Sequence
MSSTEEKTISQDAGWDWEPPMPPTDLIFDDGEPLESNRHRIAMDVLIRSLEQAWSERNDF
FAGGNMFIYYSSTQARNRDFRGPDFFVVLDADGTKSRQGWVVWEEDGRYPDVIVELMSPS
TAEVDKVTKKEIYERTFRTPNYFVYDPFNPSSLQGWQLDASHRYQPLEANERGWLWCATL
GFWLGIWEGTIQRETAPWLRFFDSSGNLVLLPEEAAQVKVQQATQQAEQERLKAERLAAQ
LRALGVEPEV
Download sequence
Identical sequences K9XH16
WP_015189667.1.9315 gi|434394011|ref|YP_007128958.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]