SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|434394161|ref|YP_007129108.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434394161|ref|YP_007129108.1|
Domain Number 1 Region: 1-178
Classification Level Classification E-value
Superfamily CheY-like 3.32e-38
Family CheY-related 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|434394161|ref|YP_007129108.1|
Sequence length 239
Comment two component transcriptional regulator, winged helix family [Gloeocapsa sp. PCC 7428]
Sequence
MRILLVEDDPAQLEPLYAALSQAGHIVDGVDDGETAQWLLSQKEYDLLILDWLLPRVSGL
SLCQQFRQAGKTAPVLMLTAKDTTADKVTGLDAGADDYLVKPTDIVELLARVRALGRRSP
LWQGDTLRMADLQLHLNSLAVERNNTIVQLSTREFQLLEYFFRHPRQVLTRDQIEEALWE
WGTEPESNAVTTLVRRLRQRLQTINAAEWIETIYGMGYRLNPPEEEERGLRSERLGVSD
Download sequence
Identical sequences K9XHE8
gi|434394161|ref|YP_007129108.1| WP_015189817.1.9315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]