SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434394178|ref|YP_007129125.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434394178|ref|YP_007129125.1|
Domain Number 1 Region: 100-260
Classification Level Classification E-value
Superfamily alpha/beta knot 6.28e-48
Family SpoU-like RNA 2'-O ribose methyltransferase 0.00042
Further Details:      
 
Domain Number 2 Region: 1-98
Classification Level Classification E-value
Superfamily L30e-like 4e-26
Family RNA 2'-O ribose methyltransferase substrate binding domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|434394178|ref|YP_007129125.1|
Sequence length 263
Comment tRNA/rRNA methyltransferase (SpoU) [Gloeocapsa sp. PCC 7428]
Sequence
MLTSLQNPLVKQLRKLHSAKERREQGVFLIEGTHLLQEACRVKYPLETVCCTPEWQSSNQ
MLWQQASQQAKRGEIVSEEVLKAIATTVNPDGVVATAPHCLERIQVPYNGLALALENVQD
PGNLGTIIRTAKAAGANGLWLSANSVDIYNPKVLRATAGQWFRLPIAISPDLRATVCKCQ
QAGMQVIATQADASLTYWEVNWQRPSLILLGNEGAGLSAELVAQSDLCVRIPQNAEVESL
NVAIAAALMLYEAQRQKMFSTAE
Download sequence
Identical sequences K9XH50
gi|434394178|ref|YP_007129125.1| WP_015189834.1.9315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]