SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434394297|ref|YP_007129244.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|434394297|ref|YP_007129244.1|
Domain Number - Region: 5-41
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0642
Family Erythroid transcription factor GATA-1 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|434394297|ref|YP_007129244.1|
Sequence length 88
Comment regulatory protein, FmdB family [Gloeocapsa sp. PCC 7428]
Sequence
MPLYEFRCDTCGPFETWRSMAQASEPMLCPSCDTLAKRIYSVAGLIFTPSALSRRIEQSA
EPKVKHRHSHTHSHHHNHHHGRPWMIGH
Download sequence
Identical sequences K9XJ26
WP_015189953.1.9315 gi|434394297|ref|YP_007129244.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]