SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434394337|ref|YP_007129284.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434394337|ref|YP_007129284.1|
Domain Number 1 Region: 14-294
Classification Level Classification E-value
Superfamily Folate-binding domain 4.55e-90
Family Aminomethyltransferase folate-binding domain 0.00000117
Further Details:      
 
Domain Number 2 Region: 286-376
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 1.28e-28
Family Aminomethyltransferase beta-barrel domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|434394337|ref|YP_007129284.1|
Sequence length 379
Comment Aminomethyltransferase [Gloeocapsa sp. PCC 7428]
Sequence
MANQEELVPEIALPLAQTPLYQLALELKARLTSFGGWEMPVQFVGISKEHQAVRTAVGMF
DISHMGKFHLRGKQLISQLQRLVPSDLNRLQPGQAQYTVLLNSQAGIIDDIIFYYQGEDG
GEQRGVMIVNAATTSKDKAWILQNIDSEYVHLHDVSSEKVLIAVQGPQAATVLQRFVQED
LSLLKAFGHLEATVLGQPGFIARTGYTGEDGFEVMVDTSIGIELWRSLYDAGVIPCGLGA
RDTLRLEAAMALYGQDIDETTTPLEAGMGWLVHLDSKEDFIGREVLAQQKAHGVQRKLVG
LRLEGRNIARHGYQVRSHSKVVGEITSGTLSPTLGYPVALAYVPTSLSQIGQQLDVEIRG
KLYPAIVVKRPFYRSKTRL
Download sequence
Identical sequences K9XJ59
WP_015189992.1.9315 gi|434394337|ref|YP_007129284.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]