SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434394451|ref|YP_007129398.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434394451|ref|YP_007129398.1|
Domain Number 1 Region: 221-463
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.91e-71
Family Leukotriene A4 hydrolase catalytic domain 0.0014
Further Details:      
 
Domain Number 2 Region: 21-214
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 6.54e-49
Family Leukotriene A4 hydrolase N-terminal domain 0.00058
Further Details:      
 
Domain Number 3 Region: 552-839
Classification Level Classification E-value
Superfamily ARM repeat 4.74e-25
Family PBS lyase HEAT-like repeat 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|434394451|ref|YP_007129398.1|
Sequence length 867
Comment Leucyl aminopeptidase [Gloeocapsa sp. PCC 7428]
Sequence
MSQLYFDTDNSRHRAFELPGAKPHYNPDRPGQVEHIFLDLNLDIPSKSYQGTCIIQLKPI
RNGIERLTLDAVNLNIYSVRVDDTPQAFEYDGSQLHIQLVSPTTVGNAIKMAIAYSAEKP
QRGIYFITPNQHYPHKPTQVWTQGEDEDSRFWFPCFDYPGQLSTSEIRVRVPKPYIAISN
GTLIDTAEEGDAKIYHWLQEQVHPTYLMTLAVGDFAEIQDEWNGKPVTYYVEKGREADAR
RSMGKTPRMIEFFSEKYGYLYPYPKYAQVCVDDFIFGGMENTSTTLLTDRCLLDERAALD
NRNTESLVAHELAHQWFGDLVVIKHWSHAWIKEGMASYSEVMWTEHEYGAEEAAYYRLLE
ARSYLAEDSSRYRRPIVTHVYREAIELYDRHLYEKGSCVYHMIRAELGEELFWQAIHTFV
QDNAHKTVETIDLLRAIEKASGRNLLFLFDQYVYRGGHPDFKVAYTWDGDSKLAKVTVTQ
TQAKEGSNGISSDLFDLKIPIAFGYTNNAESSPQLKTFTVRVHEKEQSFYFPLEEKPQFA
SFDVGNNYLKTVTLEYPLPELKAQLAFDSDPISRIYAAEALAKKGGLEAVKALSQALKQD
SFWGVRAEVAKQLAQVKLDQAFDGLVAGLEDNHPLVRRAVIEALADIKTHQSYKAIKPLV
ENGDPSYYVEASAMKAIGAIAGSTVDAKPKEEKVVKLLKSALEQRAGWNEVVRAGAIAGL
SQMKTAEPALDLILEYTKLGVPQALRLSAIRALGTISTGLNAVNLERVLQQLEELSRESF
FLTQVAVVSALGQMETPKAIGILQALANQTPDGRVRRMAEEAVSRVQSAVGSDQGVKQLR
EELDVLKQQNQELRSRLENLEAKSSQQ
Download sequence
Identical sequences K9XIA0
WP_015190106.1.9315 gi|434394451|ref|YP_007129398.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]