SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434394659|ref|YP_007129606.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434394659|ref|YP_007129606.1|
Domain Number 1 Region: 13-66
Classification Level Classification E-value
Superfamily EspE N-terminal domain-like 0.000000000225
Family GSPII protein E N-terminal domain-like 0.037
Further Details:      
 
Domain Number 2 Region: 68-122
Classification Level Classification E-value
Superfamily EspE N-terminal domain-like 0.00000178
Family GSPII protein E N-terminal domain-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|434394659|ref|YP_007129606.1|
Sequence length 131
Comment hypothetical protein Glo7428_3992 [Gloeocapsa sp. PCC 7428]
Sequence
MFTKTFERKVEKAALGEMLVRKGLITQDKLEFILAEQYRSQKQLGQILVEKQLVSQGTLN
RVLAEQQIKLGQLLIQEKLISTNALEQFLLEQQYNNKPLGKLLVEKCVISQQCLDNILEK
QYWQKKGFWLI
Download sequence
Identical sequences K9XK51
gi|434394659|ref|YP_007129606.1| WP_015190314.1.9315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]