SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|434394707|ref|YP_007129654.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434394707|ref|YP_007129654.1|
Domain Number 1 Region: 3-188
Classification Level Classification E-value
Superfamily SGNH hydrolase 1.12e-38
Family Hypothetical protein alr1529 0.00000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|434394707|ref|YP_007129654.1|
Sequence length 195
Comment lipolytic protein G-D-S-L family [Gloeocapsa sp. PCC 7428]
Sequence
MTRICFFGESFVNGTGDPECLGWTGRICAAACQQGYDITYYNLGVRRQTSTELKKRWLDE
VSCRLSPEFDSRIVFSFGVNNTTIENGKTRVDFSTSVENLSYILGVAKQMFPVLMVGPPL
TPDCEQNQRIARLSAKYAEACQKLDIAYLDTFTKLQSSTIWLQEAAANDGYHPRAGGYTE
FANIVQNWSSWLSWF
Download sequence
Identical sequences K9XK93
WP_015190362.1.9315 gi|434394707|ref|YP_007129654.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]