SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434395093|ref|YP_007130040.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434395093|ref|YP_007130040.1|
Domain Number 1 Region: 290-614
Classification Level Classification E-value
Superfamily Subtilisin-like 6.41e-53
Family Subtilases 0.00012
Further Details:      
 
Domain Number 2 Region: 65-170
Classification Level Classification E-value
Superfamily Collagen-binding domain 6.28e-16
Family Collagen-binding domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|434395093|ref|YP_007130040.1|
Sequence length 622
Comment peptidase S8 and S53 subtilisin kexin sedolisin [Gloeocapsa sp. PCC 7428]
Sequence
MLSTSRRSNEYFSVTSANESLEKLHSTSRVLESGILPEFDDPLSSNRTTYSSSLSNSVTP
QVTPDPGSNLGTAYNLGTLNRPFTLTDFVGNSDVSDIYRFNLASNSSFNLSLNGLTADAD
VELLNGNGTRLAISGASGTTSEWIDGSLNTGTYYVKVFQYTGNTNYRLSLSATPIVNGVR
SVLGNLGADTFTWQSGFNRTVISGNGNVDFGRGALDTLNLASISSTTARLNLASANGGGV
VYNPGNGARVFDAITLNNGNQVLFEGIDRIRFADRTINRFVRPNDPLFNQQWNLHMMGVH
NAWQFTKGSTNVLIGVQDSGLGVNSSGNIHPELRTTYVFPGNNYIDDFRDVFRNINHQES
HGTAVEGIIAARSNNGVGMSGINWTSPVYNIDVLGGNSGDLDIAQAAQAMINQANSQGQR
LVINMSLGTPGLSNFGRTDIFPAFNQVVANNPNVLFVIAAGNEGHLGASGISYPATLASL
YNNVIAVGASWGTRSANNFATTPGDRISYPGWWGSQYGTGLTLMGPSEVIAPYADRYGRF
SYWGTGSIPGFNGTSAAAPNVAGVASLVWSANRNLSATRIKQILSQTAFDLGARSYDTVY
GHGFVNADAAVRRAMAIGRGAA
Download sequence
Identical sequences K9XJT3
gi|434395093|ref|YP_007130040.1| WP_015190747.1.9315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]