SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434395115|ref|YP_007130062.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434395115|ref|YP_007130062.1|
Domain Number 1 Region: 334-473
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.13e-30
Family Potassium channel NAD-binding domain 0.0066
Further Details:      
 
Domain Number 2 Region: 1-141
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 7.22e-18
Family Potassium channel NAD-binding domain 0.017
Further Details:      
 
Domain Number 3 Region: 173-315
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000863
Family Voltage-gated potassium channels 0.013
Further Details:      
 
Weak hits

Sequence:  gi|434395115|ref|YP_007130062.1|
Domain Number - Region: 488-552
Classification Level Classification E-value
Superfamily TrkA C-terminal domain-like 0.0458
Family TrkA C-terminal domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|434395115|ref|YP_007130062.1|
Sequence length 561
Comment TrkA-N domain protein [Gloeocapsa sp. PCC 7428]
Sequence
MKPRIIVCGLERTGYKIFCLLRQQGASVVGIHHQPIPKEETIVVGDLQAAATLQAASIET
AQTLVLANSDDALNLAILIQARVLNPRIRIINRLFNANLGDRLDHTLPDHVSMSVSGLAA
PVFYFAALGNRAIGQLKLFNQTWPIQEEYIHENHPWRGRLLSDLWDDRARMLIYYLPVQG
EIDLVCAVSSGQQLQVGDRLIVGTQPSIRTMRKSALSKLLKVVTNLRQFRQHGQSLMVVT
LVLLITIFTATLTYICFDLNTSLIDALYFSVGMITGAGGKEEVVEKAPDSIKVFTAFMML
IGAGIIGICYALLNDFVLGTRFKQFWDAARVPQRHHYIVCGLGGIGVQVVQQFHASGHEV
VVIERDSNNRFLNTARGLGIPVIQGDASLPETLQAANLKSASALLIVTSNDAVNLEIALN
AKTLTPSIPAIVRYEHPDFAHMAQQVFEFEAVLSPAELAAPAFAAAALGGRILGNGITAD
SLWVALATLITPSHPFCGQRVKETAMQSDFVPLYIETNCQTIHGWDLLGTYLSAGDVLYL
TMPANRLDHLWRAVPSQIMVS
Download sequence
Identical sequences K9XMI8
gi|434395115|ref|YP_007130062.1| WP_015190769.1.9315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]