SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434395236|ref|YP_007130183.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434395236|ref|YP_007130183.1|
Domain Number 1 Region: 22-263
Classification Level Classification E-value
Superfamily YjeF N-terminal domain-like 7.59e-60
Family YjeF N-terminal domain-like 0.00021
Further Details:      
 
Domain Number 2 Region: 240-520
Classification Level Classification E-value
Superfamily Ribokinase-like 2.31e-57
Family YjeF C-terminal domain-like 0.0000619
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|434395236|ref|YP_007130183.1|
Sequence length 524
Comment YjeF-related protein [Gloeocapsa sp. PCC 7428]
Sequence
MFNSESPLPNTTTRHEQISRVVVTAQQMRDIEARIFAEGMPVAALMEKVAGLIARRIIEL
YPRSHFPCIGILVGPGHNGGDALVVARELHFQGYDIAVCCPFSKLKDLTAQHAQYVKSLG
IPVYEALEPLAKCAVFVDGLFGFGLERSLSSPVDRIVDQLNEWSQPVVSIDLPSGIHTDT
GEVLGTAVQATQTFCLGLWKLGLLQDQALDYVGQAELIDFDIPIADIQAVLETPKIKRIT
PQSAIATLPLKRSPVTHKYKQGHLLLICGSRRYTGGAILTGLGTRASGVGMLSIAVPESI
KPLLSAQLPEALIVGCPETASGAIAQLQLPEQTDLSSFDAIACGPGLTVDAKPILQEVMN
SDRPLVLDADGLNILAQMGTIPTLQRRQAPTVLTPHAGEFKRLFPDTVDPTNDQIAAVRA
AAAQSGAVVLLKGARTAIADTDYVWINSESTPALARGGSGDVLTGLLGGLIAQATTKHIP
LLEIVASAAWWHSQAGILAARDRTEMGVDAFTLTQYLMSVVRSS
Download sequence
Identical sequences K9XKG8
WP_015190890.1.9315 gi|434395236|ref|YP_007130183.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]