SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434395300|ref|YP_007130247.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434395300|ref|YP_007130247.1|
Domain Number 1 Region: 128-401
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 3.18e-107
Family BC ATP-binding domain-like 0.00000000878
Further Details:      
 
Domain Number 2 Region: 698-964
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 3.01e-102
Family BC ATP-binding domain-like 0.000000157
Further Details:      
 
Domain Number 3 Region: 396-552
Classification Level Classification E-value
Superfamily Carbamoyl phosphate synthetase, large subunit connection domain 3.79e-55
Family Carbamoyl phosphate synthetase, large subunit connection domain 0.0000902
Further Details:      
 
Domain Number 4 Region: 1-127
Classification Level Classification E-value
Superfamily PreATP-grasp domain 3.6e-49
Family BC N-terminal domain-like 0.00000203
Further Details:      
 
Domain Number 5 Region: 556-654,681-700
Classification Level Classification E-value
Superfamily PreATP-grasp domain 8.34e-44
Family BC N-terminal domain-like 0.00000387
Further Details:      
 
Domain Number 6 Region: 967-1102
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 4.19e-37
Family Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|434395300|ref|YP_007130247.1|
Sequence length 1105
Comment carbamoyl-phosphate synthase large subunit [Gloeocapsa sp. PCC 7428]
Sequence
MPRRDDIQKILLLGSGPIVIGQACEFDYSGTQACKALREEGYQVVLVNSNPATIMTDPET
ADRTYIEPLTPEIVEKIIAKERPEALLPTMGGQTALNIAVALSKNGVLEKYGVELIGAKL
PAIEKAEDRQLFKEAMEKIGVGVCPSGIASTVDEARAIAKQIGSYPLIIRPAFTMGGTGG
GIAYNQEEFETMAQGGIDASPVSQILIEQSLLGWKEYELEVMRDLADNVVIICSIENLDP
MGIHTGDSITVAPAQTLTDKEYQRLRDASIRIIREIGVETGGSNIQFAVNPVDGDVIVIE
MNPRVSRSSALASKATGFPIAKFAAKLAVGYTLDEIKNDITKKTPASFEPTIDYVVTKIP
RFAFEKFPGSEPVLTTQMKSVGEAMAIGRTFQESFQKALRSLETGRAGWGCDRAEKLPSG
EQIRAQLRTPNPERIFAVRHAMQLGLSTEDIYELTGIDPWFLDKMQQLLETEKFLKRTPL
EKLTKEQFYAVKRQGFSDRQIAFATKTTEDAVRAYRKQLGVIPVYKTVDTCAAEFEAYTP
YHYSTYEEESEVQPSDKQKVMILGGGPNRIGQGIEFDYCCCHASYALKAAGFETIMVNSN
PETVSTDYDTSDRLYFEPLTKEDVLNIIEAEQPVGIIIQFGGQTPLKLAVPLQEYLSKVG
NGSSVIGATDNQSPITNHQLPITKIWGTSPDSIDTAEDRERFEKILHELDIAQPPNGIAR
SYQDALVIASRIGYPVVVRPSYVLGGRAMEIVYSDADLERYMTFAVQVEPDHPILIDKFL
ENAIEVDVDAIADTTGKVVIGGIMEHIEQAGIHSGDSACSLPAISLPSSVLNKIRTWTVQ
LAQRLQVVGLMNIQFAVVGAHSYNPQVYILEANPRASRTVPFVSKTTGIPLAKMASLIMS
GETLESLNFTQEPLPNHIAVKEAVLPFNKFPGTDTILGPEMRSTGEVMGIDSDFGKAFAK
AELGAGETLPRQGTVFVSMSDRDKSLVVPVVKDFIELGFKVVATDGTRRVLKEHGLDVEL
ILKLHEGRPNVLDAIKNQQIQLIINTPSGEEAQTDARLIRRTALGYKIPIITTIAGAKAT
AAAIRSLQATSLEVKAIQDYIGANK
Download sequence
Identical sequences K9XN49
WP_015190954.1.9315 gi|434395300|ref|YP_007130247.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]