SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434395326|ref|YP_007130273.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434395326|ref|YP_007130273.1|
Domain Number 1 Region: 66-212
Classification Level Classification E-value
Superfamily FtsH protease domain-like 6.28e-17
Family FtsH protease domain-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|434395326|ref|YP_007130273.1|
Sequence length 232
Comment hypothetical protein Glo7428_4680 [Gloeocapsa sp. PCC 7428]
Sequence
MSQTALNLTAIAIFLMTMTALLGPMFNLSPTLPAIATFSLLGLATLDSFSLQGKGGTLVL
DWFASFSPQHRDRIVRHEAGHFLVAHLLGIPVTGYALSAWEALKQKQPGQGGVSFDDTEV
ASQLAQGTISTQLLDRYCTIWMAGVAAETLVYDRAEGGADDRQHLHTVLSSLGFSAASVE
LKQRFCSLQARNLLQQNWAAYEALINAMRQRADVAECRNLIDSLTVTSSPVI
Download sequence
Identical sequences K9XKU2
WP_015190980.1.9315 gi|434395326|ref|YP_007130273.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]