SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434395400|ref|YP_007130347.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434395400|ref|YP_007130347.1|
Domain Number 1 Region: 275-525
Classification Level Classification E-value
Superfamily HemD-like 1.19e-71
Family HemD-like 0.00084
Further Details:      
 
Domain Number 2 Region: 20-256
Classification Level Classification E-value
Superfamily Tetrapyrrole methylase 7.33e-66
Family Tetrapyrrole methylase 0.00000332
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|434395400|ref|YP_007130347.1|
Sequence length 526
Comment uroporphyrin-III C-methyltransferase [Gloeocapsa sp. PCC 7428]
Sequence
MTDDRLPVTKNQLPAIMNAQGKVYLVGAGLGNVGYLTVKALQLLAQAEVLIYDALVDDQL
LQLVPKNCLKLDVGKRGGKPSTPQAEINHLLVEHCQRGKQVVRLKSGDPFIFGRSAAEID
ALMANNCRFEVVPGISSALAAPLLAGIPLTDPTISSCFAVFTAHEPEKLDWEALARLETL
VILMGGKQLSTVVQQLLHYGRSPQTPIAIVKWAGTQKQQTWTSDLANIQTVTAGVSLSPV
VMIIGEVVALREQLNAKIEIEFPALDMLPDQPLHGKTILVTRSAGQSSNARDRLAMLGAN
VIEMPALEIGPPSSWEDLDRAIAHIADFDWLILTSTNGVEYFFARLAIQGKDARALAGVK
IAVVGEKTAQILAQQGLQPDFIPPNFIADSLVEHFPEPLQGKKVLFPRVETGGREVLVKE
FTMKGADVVEVAAYESRCPQRISPDALKALQQQAVDVITFASSKTVQNFCQLLANHGGAN
LDSVCIASIGPLTSKACQQQFGRVDIEATEYTLEGLTQAIVQWVQR
Download sequence
Identical sequences K9XNC0
gi|434395400|ref|YP_007130347.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]