SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434395410|ref|YP_007130357.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434395410|ref|YP_007130357.1|
Domain Number 1 Region: 705-996
Classification Level Classification E-value
Superfamily TPR-like 9.48e-64
Family Tetratricopeptide repeat (TPR) 0.0027
Further Details:      
 
Domain Number 2 Region: 511-615
Classification Level Classification E-value
Superfamily Apolipoprotein 0.00000118
Family Apolipoprotein 0.0095
Further Details:      
 
Domain Number 3 Region: 132-307
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0000366
Family Apolipoprotein A-I 0.033
Further Details:      
 
Weak hits

Sequence:  gi|434395410|ref|YP_007130357.1|
Domain Number - Region: 403-543
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.000575
Family Apolipoprotein A-I 0.0032
Further Details:      
 
Domain Number - Region: 297-393
Classification Level Classification E-value
Superfamily Apolipoprotein 0.0798
Family Apolipoprotein 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|434395410|ref|YP_007130357.1|
Sequence length 1022
Comment Tetratricopeptide TPR_1 repeat-containing protein [Gloeocapsa sp. PCC 7428]
Sequence
MKRKQKQILKSLSHGSGVFLSTFLLSVGAVGFANAESVIPDASESRAETTVLAQLQPQSP
PTAQGNAQSISLTNILLATLVVLLGAALVSLFLLRKSVIRGVADIVIMRLKELEDVQNGI
ANADRKIQGILQDAEEILDEINHEAEELQQEIAAQRENLSQVLAHLSQSQQQANVKLENQ
FKTSAQAIKKLENEFAAQLASLKQQTQQQQTLILQNLKQLQDDFSPHLLEIRTEVQTQKD
TVLQHLEQSRVELINQLTQIQQQTEQQRNAIFQNLEQIVSEFAPQLSTLHAEVQAQKDTV
IQNLQRSETELAEQVAQIQQQLQTQRSTISQDIERLLTEFNPQISEIQSEIQNKKDVVLE
NIRQSEVDLAEQLQQIQQQAQQQYDETLDNLEQLALGFSPDVSEIQAEIQEEKDAIIQSL
QQARKEFAVQLAQLQQQAQKQRDFLLKNLKKQASELVPQLTELQADVQDEKDAAIQSIRQ
TEAEFVSQISELQSEIQEQKGEAVYQLEGIETEIEERIAGLQDEVQKQQELIRKNLKQLE
ENLAPYLSEIQTDAVEKLQQQKDAMLEDLQQLQTEIAEQIKEFQARMQAQIEQEIQSLRS
QATEFATQVSDSQSGVQSQQNATIENLEKLASEWSNQLAALQSEITNRKELTLENLDKLE
NRLETELAEVKSDAQARKEQILRQLAEIAPTSIAQAALADVSQQIQALSEQLELLKTNYP
QLFMRPDDYINQGNALFAEGRYQEAIATYEQALEIQPNNPDLCYQQGLALWELKQYESAI
AAFDKVLEIKPDDAASWYHRGLALKELKRYEGAFAAFSQVIQVQPENSDAWFNRGIVLSR
MKRYKDAIASYDKAIEINPNHHLAWVDRGVALGKLQNHEEAFQSFDRAVQVKPDDAVAWM
NRAMALEVLEKLEDAIASYDKAIELDPDYYKAWNAKGYLLVQLERDPEALESFDRALQIQ
PDYPNAYYNKAICYAFQGQVKLALENLQKAIELNPKYRAEASSDPDFESIATTRGFRQLI
EG
Download sequence
Identical sequences K9XNC7
gi|434395410|ref|YP_007130357.1| WP_015191064.1.9315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]