SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434395491|ref|YP_007130438.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434395491|ref|YP_007130438.1|
Domain Number 1 Region: 58-110,237-422
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.11e-54
Family Bacterial dinuclear zinc exopeptidases 0.0079
Further Details:      
 
Domain Number 2 Region: 130-235
Classification Level Classification E-value
Superfamily PA domain 6.93e-20
Family PA domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|434395491|ref|YP_007130438.1|
Sequence length 439
Comment peptidase M28 [Gloeocapsa sp. PCC 7428]
Sequence
MNKLHNSLFPATRSQKSLQRIVRLLIAGASVASVGLVGCTPAIEVQADRGRLLSQTDTVV
SSRAIADVQALVKLGPRVTGTPVMEQARAYLIEQYTRAGYETRTQTFTYPKFEDLGSSIT
INGQIRNGRALNGSIPGKPSARLVAVPNVGQRSDFATVDVKGAIAVVRRGEIPFLQKAQN
AANAGAVGVVIVNNEPGELYGTLGGEVQIPVLALSGKAGNSLIESQPSQGTLTVNTRQRT
VTGTNVIAHLPGVTQPRVVVGAHYDSVPGSPGANDNASGTAVVLDIARNVAQTPLAREAW
FVVFDGEEDGLHGSRAFVSQAQPDWLQGLDAMFNFDMVGVNDQLLVGGSQSLTKLAQVTQ
SDISTFGGQGGSDHAPFARVGVPVLFFYRGQEPNYHTPNDKAVEPQLLDETTQVALNVLQ
QLLGSDTSDRISLMRRSVL
Download sequence
Identical sequences K9XL92
gi|434395491|ref|YP_007130438.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]