SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434395755|ref|YP_007130497.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434395755|ref|YP_007130497.1|
Domain Number 1 Region: 36-160
Classification Level Classification E-value
Superfamily ParB/Sulfiredoxin 2.44e-28
Family ParB-like nuclease domain 0.00049
Further Details:      
 
Domain Number 2 Region: 120-148,180-262
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 3.79e-20
Family KorB DNA-binding domain-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|434395755|ref|YP_007130497.1|
Sequence length 314
Comment parB-like partition protein [Gloeocapsa sp. PCC 7428]
Sequence
MTRQPSSRRKSDKPYKSQANLDVLFGEEEVATSSQTVKLDAIILPERQPRRYFDPEKLEQ
LTESIKAHGILENLLIRPVEEKEGLYELVAGERRYRAAQAAGLTEVPVAIRQLTDEQAIQ
VSLVENLQREDLNPVEETEAILQLLASRLKSAESDVSSLLYRMLNDVQRMTNNVISQPEA
ETVKQVFAELGLMEWESFINNRLPLLRLPEEILEALRSGQIEYTKAKVIASVKDEQQRKE
LLAQAIQENLSLSRIRERLNSIQPNKVSSPSPQSHIQTISRRLNQSKLWDKDPKKWKQVQ
GWLQKIEKLLEEGQ
Download sequence
Identical sequences K9XNR8
WP_015191204.1.9315 gi|434395755|ref|YP_007130497.1| gi|434395755|ref|YP_007130497.1|NC_019746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]