SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434395790|ref|YP_007130532.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|434395790|ref|YP_007130532.1|
Domain Number - Region: 382-477
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 0.00139
Family Hjc-like 0.07
Further Details:      
 
Domain Number - Region: 92-116
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.00188
Family Rubredoxin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|434395790|ref|YP_007130532.1|
Sequence length 493
Comment Protein of unknown function DUF1998 [Gloeocapsa sp. PCC 7428]
Sequence
MGLNEGKSNSEFEFYPYRYFAAEGFLPGFNFPRLPVRAYIPTEDGGEFISRPRTVALREF
APSNIVYYEGSKFMVAKTKVPVSGIDSQYKRVSVCFNCGYFHEGNFRDTCENCDAAIKND
RYENIAKLTRVLPMETAIARRRERITCDEEERLKYGYNVTTHFRYDSQKQESATVQSVEG
TPLLRLTYGATAKIWRINRGLKKNIDERGFKLDTKTGFWGDPRNEQATESLHTEVNLMVN
DTCNILVIEPLSVPVENSEAFIATLQYTLETAIQAVYKLEADELDSERLGEGKYLLFWEA
AEGGAGVLSQLLEKPEAFQKIANAALDICHFNQPKESCVQACYECLLSYRNQFDHALINR
HYIKPLLDQLLASKVVGNFEGMSREERYQQLLQQTDPNSNFERVVLQEIYQRGYKLPDAA
QELIPLANCKPDFIYKTNAAIAIFCDGSVHDSPDKRRQDQIERDNLRYNTGYTVLTLRHD
QDWEAKLSILASL
Download sequence
Identical sequences K9XNW0
gi|434395790|ref|YP_007130532.1|NC_019746 gi|434395790|ref|YP_007130532.1| WP_015191239.1.9315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]