SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434391063|ref|YP_007126010.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434391063|ref|YP_007126010.1|
Domain Number 1 Region: 5-160
Classification Level Classification E-value
Superfamily RNase III domain-like 5.93e-35
Family RNase III catalytic domain-like 0.00037
Further Details:      
 
Domain Number 2 Region: 119-236
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 1.65e-22
Family Double-stranded RNA-binding domain (dsRBD) 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|434391063|ref|YP_007126010.1|
Sequence length 243
Comment RNAse III [Gloeocapsa sp. PCC 7428]
Sequence
MILNYPRRQKQLEKLIEKLGLPTQAPVQWHLLDLALTHSSVSAQANYEQLEFIGDAVVRL
VAAEVLWETYPECPVGEFAAIRSVLVSDRILATLADEYDLGMYLLVAGSATGDKAGEESR
LADAFEAVLGALYLSTHNLELVRPWLDLHFKQLAAQIRSDPARLNYKAALQEWTQAHYKI
LPEYRVQEIHHHSNIHDRFTAQVWLQGRKLGQGTGRSIKAAEQAAAQAAFLALNSQAPEM
VKS
Download sequence
Identical sequences K9X883
WP_015186727.1.9315 gi|434391063|ref|YP_007126010.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]