SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434391393|ref|YP_007126340.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434391393|ref|YP_007126340.1|
Domain Number 1 Region: 6-359
Classification Level Classification E-value
Superfamily Dehydroquinate synthase-like 2.09e-113
Family Dehydroquinate synthase, DHQS 0.00000512
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|434391393|ref|YP_007126340.1|
Sequence length 362
Comment 3-dehydroquinate synthase [Gloeocapsa sp. PCC 7428]
Sequence
MHTIRLNLPQQAYDIAIALGGIAKLGELMSHLSLGKKVLLVSNPTVFQHYGDRAIASLEN
AGFDVNSYNLPDGEQHKTLASVEKLYNTALENRLERSSTMVALGGGVIGDMTGFAAATWL
RGINFVQVPTTLLSMVDAAIGGKTGVNHPQGKNLIGAFHQPKLVLIDPQVLRTLPEREFR
AGMAEVIKYGVIWDAELFAQMEKCDRLDQLHYLSESLLQEILVRSCQAKADVVSKDEKEA
GLRAILNYGHTIGHAVESLTRYRVVNHGEAVAIGMVAAGQLAVNLGLWQQASQDRQLALI
QKTGLPTRLPEGLDLDAIVDSLQTDKKVKAGKVRFVLPTQIGVVKVTDQVSSEQIHQVLH
QM
Download sequence
Identical sequences K9X964
WP_015187057.1.9315 gi|434391393|ref|YP_007126340.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]