SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|220930982|ref|YP_002507890.1| from Halothermothrix orenii H 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220930982|ref|YP_002507890.1|
Domain Number 1 Region: 80-159
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.87e-27
Family Translational machinery components 0.00011
Further Details:      
 
Domain Number 2 Region: 9-76
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 1.57e-24
Family Ribosomal S5 protein, N-terminal domain 0.0000914
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|220930982|ref|YP_002507890.1|
Sequence length 166
Comment 30S ribosomal protein S5 [Halothermothrix orenii H 168]
Sequence
MKNIDPDKLDLEERVVNINRVAKVVKGGRRFSFSALVVVGDGNGHVGVGFGKANEVPEAI
RKGVEDGKKNLIKVPIVNTTIPHEIVGEFGAGKVLLKPAAPGTGVIAGGPVRAVVELAGI
GDILTKSLGSSNPINMVKATLTGLSQLKTIEEVADLRGKDVEELMG
Download sequence
Identical sequences B8D0E1
373903.Hore_01340 gi|220930982|ref|YP_002507890.1| WP_012635093.1.20074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]