SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220932527|ref|YP_002509435.1| from Halothermothrix orenii H 168

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|220932527|ref|YP_002509435.1|
Domain Number - Region: 104-141
Classification Level Classification E-value
Superfamily Phase 1 flagellin 0.0183
Family Phase 1 flagellin 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|220932527|ref|YP_002509435.1|
Sequence length 145
Comment flagellar basal-body rod protein FlgC [Halothermothrix orenii H 168]
Sequence
MLDSLNISASGLTAQRLRMDIIADNIANVNTTRTEDGGPYRRKLPVFREREADSFARVFQ
SKLGKDTDRRGVEVVGIREDDSPFKMVYNPGHPDANEEGYVAMPNVNITTEMVDMISASR
AYEANVTALNTAKNMALKALQIGQG
Download sequence
Identical sequences B8CYS1
gi|220932527|ref|YP_002509435.1| WP_015923410.1.20074 373903.Hore_16910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]