SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|220932780|ref|YP_002509688.1| from Halothermothrix orenii H 168

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|220932780|ref|YP_002509688.1|
Domain Number - Region: 24-104
Classification Level Classification E-value
Superfamily YheA/YmcA-like 0.00401
Family YheA-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|220932780|ref|YP_002509688.1|
Sequence length 107
Comment hypothetical protein Hore_19460 [Halothermothrix orenii H 168]
Sequence
MREELIEALIQVEKDARRLEEEGHKEAKKLCKYYRQKMDQEKEKRLLKARQEGKNLVKQA
EQEAREYAQQLEKNKAKELKEMEARFNRIKSDVVNKYFKQITGFEGE
Download sequence
Identical sequences B8CZH4
gi|220932780|ref|YP_002509688.1| WP_015923662.1.20074 373903.Hore_19460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]