SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222529151|ref|YP_002573033.1| from Caldicellulosiruptor bescii DSM 6725

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222529151|ref|YP_002573033.1|
Domain Number 1 Region: 2-156
Classification Level Classification E-value
Superfamily RNase III domain-like 4.53e-47
Family RNase III catalytic domain-like 0.00015
Further Details:      
 
Domain Number 2 Region: 108-219
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 4.24e-19
Family Double-stranded RNA-binding domain (dsRBD) 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|222529151|ref|YP_002573033.1|
Sequence length 222
Comment ribonuclease III [Caldicellulosiruptor bescii DSM 6725]
Sequence
MEEIEKALGYKFMDKNLLRLALTHKSATHSNKNCYERLEFLGDAALELVVSKYLFVHFPE
LSEGELTNIRAAVVCSQTLSKIAEKLNLKNHIIFGKREKMEKFHENKSILTDVVEAIFGA
IFIESGFEKLEKIIVNLLKPYIQKAVAGKLFYDYKTKLQEFVQKKGQKKIVYKDYEIIEK
KYFKSELFIEGKKVSEGYGTSKKEAQQDAAYKFLLEMGEQEE
Download sequence
Identical sequences A0A2G6VJF9 B9MRF6
gi|222529151|ref|YP_002573033.1| WP_015907657.1.1144 WP_015907657.1.22435 WP_015907657.1.28668 WP_015907657.1.33084 WP_015907657.1.45436 WP_015907657.1.58293 WP_015907657.1.61668 WP_015907657.1.71443 WP_015907657.1.77617 WP_015907657.1.9959 521460.Athe_1159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]