SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|225859736|ref|YP_002741246.1| from Streptococcus pneumoniae 70585

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|225859736|ref|YP_002741246.1|
Domain Number 1 Region: 33-147
Classification Level Classification E-value
Superfamily Apolipoprotein 0.0000128
Family Apolipoprotein 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|225859736|ref|YP_002741246.1|
Sequence length 418
Comment competence-induced protein Ccs50 [Streptococcus pneumoniae 70585]
Sequence
MESLLILLLIANLAGLFLIWQRQDRQEKHLSKSLEDQADHLSDQLDYRFDQARQASQLDQ
KDLEVAVSDRLQEVRIELHQGLTQVRQEMTDNLLQTRDKTDQRLQALQESNEQRLEQMRQ
TVEEKLEKTLQTRLQASFETVSKQLESVNRGLGEMQTVARDVGALNKVLSGTKTRGILGE
LQLGQIIEDIMTPAQYEREYATVENSSERVEYAIKLPGQGDQEYVYLPIDSKFPLADYYR
LEEAYETGDKDEIERCRKSLLASVKRFAKDIKSKYIAPPRTTNFGILFVPTEGLYSEIVR
NPVFFDDLRREEQIIVAGPSTLSALLNSLSVGFKTLNIQKSADHISKTLASVKTEFGKFG
GILVKAQKHLQHASGNIDELLNRRTIAIERTLRHIELSEGEPALDLLHFQENEEEYED
Download sequence
Identical sequences A0A0B7LBS1 C1CA25
gi|307068589|ref|YP_003877555.1| 488221.SP70585_2052 gi|405760144|ref|YP_006700740.1| gi|225859736|ref|YP_002741246.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]