SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|241204687|ref|YP_002975783.1| from Rhizobium leguminosarum bv. trifolii WSM1325

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|241204687|ref|YP_002975783.1|
Domain Number 1 Region: 79-338
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 5.1e-65
Family L-arabinose binding protein-like 0.0000626
Further Details:      
 
Domain Number 2 Region: 2-55
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000000000938
Family GalR/LacI-like bacterial regulator 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|241204687|ref|YP_002975783.1|
Sequence length 352
Comment LacI family transcriptional regulator [Rhizobium leguminosarum bv. trifolii WSM1325]
Sequence
MRVTMMDIAAAAGCSQAAVSFVLNDTPGTRISQQTRDRVWEAARELGYMEKTYATKASYS
GLDNVIGFAVDQLATSPEAIVAIEGARQASWNAGNVLLVTQTLSDPVMEPKAIEALTSGG
ISALIYMTIYTRQVELPSYVCELNIPTVLLNCYTADHAFPAVVPSEIAGGQSSTRHLITH
GHHRIATITGEIWMQAAQDRLTGYRRALATADIPFDPELVIEGDWSASAGYASTMKLLAL
KEPPTAIFCQNDRTAIGCYEALKDAGLRIPQDMSVVGYDDEEISRHLVPPLTTSVLPHLA
MGQWAIEHLNPESIPGKRYPIAKLECSLVKRHSVAAPRAEARQILDGAHTSS
Download sequence
Identical sequences C6AXV3
395491.Rleg_1962 gi|241204687|ref|YP_002975783.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]