SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|241666501|ref|YP_002984585.1| from Rhizobium leguminosarum bv. trifolii WSM1325

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|241666501|ref|YP_002984585.1|
Domain Number 1 Region: 110-226
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 4.85e-25
Family Aromatic dioxygenase reductase-like 0.0097
Further Details:      
 
Domain Number 2 Region: 7-104
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 4.04e-24
Family Ferredoxin reductase FAD-binding domain-like 0.0022
Further Details:      
 
Domain Number 3 Region: 215-315
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.04e-19
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|241666501|ref|YP_002984585.1|
Sequence length 321
Comment ferredoxin [Rhizobium leguminosarum bv. trifolii WSM1325]
Sequence
MSGGTEIPVRVVRITPIAERVKRFRFERLDGKPMPYFSGGAHVIVLMNDGGHMRRNAYSL
MSPPHDCAAYEISVLHVENSRGGSTFMHEKVSEGDELKVSYPVNLFQPDWRGRKHLLIAG
GIGITPFIAMMEQFSREGANFELHYAIRTRDRGAYWQHLVARYGGHRIKIYCDAEGGAMP
LTRLLGTQPLGTHLYVCGPSGMIDGVLKSGLDAGWPEQNLHSERFLSSLPGKPFAIELLR
SGKTVKVGHHESMLEAIEAAGVDAPFLCRGGACGQCETGVVTCDGKLLHHDVYLTNEEKA
SGRKVMICVSRFEGNTLHLDL
Download sequence
Identical sequences C6B6B5
gi|241666501|ref|YP_002984585.1| 395491.Rleg_6582 gi|241666501|ref|YP_002984585.1|NC_012858 WP_012763168.1.14669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]