SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|241667032|ref|YP_002985116.1| from Rhizobium leguminosarum bv. trifolii WSM1325

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|241667032|ref|YP_002985116.1|
Domain Number 1 Region: 153-407
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.56e-44
Family L-arabinose binding protein-like 0.00013
Further Details:      
 
Domain Number 2 Region: 95-153
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 5.32e-16
Family GalR/LacI-like bacterial regulator 0.0067
Further Details:      
 
Weak hits

Sequence:  gi|241667032|ref|YP_002985116.1|
Domain Number - Region: 6-49
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.0497
Family L-arabinose binding protein-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|241667032|ref|YP_002985116.1|
Sequence length 439
Comment LacI family transcriptional regulator [Rhizobium leguminosarum bv. trifolii WSM1325]
Sequence
MRSVVLLIRFDDVPESSWVSYPLPTQDPLTMAQRAFELMERRLENPGLASGLRTRHFRSS
SSARASDLTLPRLFAGAILWQEGLTRDPGGRSTQMKGIRQLAEHLDISIGTVSRALNGKP
DVNDETRRRVLAAAEELGYVANQSGRSLRQGTTNVIGLMLEVSRETVENSDDFFLGVTDG
LQRVFSRHKLDLVMLPCPDDEDPHEYLKRMVARRLVDALIISATRRTDRRIELLEKARIP
FVALGRSASGGSYTWMDLDFEGVATRGVDRLVAKGHRRIAVAVPSSDINLGYLFLDAYRQ
ALQRHGIPFDPTLVIRVKSSEQGGYQAGHELLMIGERPTAIILIHELMAIGLYRRLAEAG
VVPGRDLAVVGFREEPRTLFLQPTLTSFRMSLRDLGAQLGETLLATMPAYADHYPQGARN
RIWPLELVPGESDAFMLTA
Download sequence
Identical sequences C6B7U6
gi|241667032|ref|YP_002985116.1| 395491.Rleg_7146 gi|241667032|ref|YP_002985116.1|NC_012858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]