SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|480533430|ref|YP_007765633.1| from Streptococcus pneumoniae SPN034156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|480533430|ref|YP_007765633.1|
Domain Number 1 Region: 121-268
Classification Level Classification E-value
Superfamily 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK 2.49e-49
Family 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK 0.00016
Further Details:      
 
Domain Number 2 Region: 2-119
Classification Level Classification E-value
Superfamily Tetrahydrobiopterin biosynthesis enzymes-like 2.8e-27
Family DHN aldolase/epimerase 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|480533430|ref|YP_007765633.1|
Sequence length 270
Comment putative2-amino-4-hydroxy-6-hydroxymethyldihydropteridinepyrophosphokinase [Streptococcus pneumoniae SPN034156]
Sequence
MDQLQIKDLEMFAYHGLFPSEKELGQKFVVSAILSYDMTKAATDLDLTASVHYGELCQQW
TTWFQETSEDLIETVAYKLVERTFEFYPLVQEMKLELKKPWAPVHLSLDTCSVTIHRRKQ
RAFIALGSNMGDKQANLKQAIDKLRARGIHILKESSVLATEPWGGVEQDSFANQVVEVET
WLPAQDLLETLLAIESELGRVREVHWGPRLIDLDLLFVEDQILYTDDLILPHPYIAERLF
VLESLQEIAPHFIHPILKQPIRNLYDALKK
Download sequence
Identical sequences A0A292GDT7 P22291
gi|387756844|ref|YP_006063823.1| WP_000372529.1.100001 WP_000372529.1.100579 WP_000372529.1.10118 WP_000372529.1.101517 WP_000372529.1.101577 WP_000372529.1.10337 WP_000372529.1.1083 WP_000372529.1.11102 WP_000372529.1.11657 WP_000372529.1.12023 WP_000372529.1.12413 WP_000372529.1.12430 WP_000372529.1.12723 WP_000372529.1.12786 WP_000372529.1.13729 WP_000372529.1.14217 WP_000372529.1.1432 WP_000372529.1.14959 WP_000372529.1.15104 WP_000372529.1.15305 WP_000372529.1.15761 WP_000372529.1.15797 WP_000372529.1.15854 WP_000372529.1.16302 WP_000372529.1.16730 WP_000372529.1.16947 WP_000372529.1.17063 WP_000372529.1.17178 WP_000372529.1.17227 WP_000372529.1.17238 WP_000372529.1.17263 WP_000372529.1.17420 WP_000372529.1.17438 WP_000372529.1.18215 WP_000372529.1.18528 WP_000372529.1.19104 WP_000372529.1.19420 WP_000372529.1.19942 WP_000372529.1.20207 WP_000372529.1.21095 WP_000372529.1.21701 WP_000372529.1.22506 WP_000372529.1.22636 WP_000372529.1.22655 WP_000372529.1.23018 WP_000372529.1.23077 WP_000372529.1.24102 WP_000372529.1.24247 WP_000372529.1.24844 WP_000372529.1.25084 WP_000372529.1.25507 WP_000372529.1.25538 WP_000372529.1.25545 WP_000372529.1.25792 WP_000372529.1.25966 WP_000372529.1.26085 WP_000372529.1.26111 WP_000372529.1.26389 WP_000372529.1.26484 WP_000372529.1.26793 WP_000372529.1.26807 WP_000372529.1.26875 WP_000372529.1.27131 WP_000372529.1.27151 WP_000372529.1.27315 WP_000372529.1.27573 WP_000372529.1.27721 WP_000372529.1.27865 WP_000372529.1.27964 WP_000372529.1.28460 WP_000372529.1.28772 WP_000372529.1.28931 WP_000372529.1.29205 WP_000372529.1.30065 WP_000372529.1.30167 WP_000372529.1.30243 WP_000372529.1.30406 WP_000372529.1.30757 WP_000372529.1.3084 WP_000372529.1.30891 WP_000372529.1.31755 WP_000372529.1.3211 WP_000372529.1.32186 WP_000372529.1.32771 WP_000372529.1.33091 WP_000372529.1.33458 WP_000372529.1.33791 WP_000372529.1.33808 WP_000372529.1.33882 WP_000372529.1.34041 WP_000372529.1.34083 WP_000372529.1.34212 WP_000372529.1.34474 WP_000372529.1.34792 WP_000372529.1.34796 WP_000372529.1.35020 WP_000372529.1.35027 WP_000372529.1.35254 WP_000372529.1.35773 WP_000372529.1.35967 WP_000372529.1.36077 WP_000372529.1.36214 WP_000372529.1.36450 WP_000372529.1.36982 WP_000372529.1.37024 WP_000372529.1.37447 WP_000372529.1.38109 WP_000372529.1.38275 WP_000372529.1.38324 WP_000372529.1.38497 WP_000372529.1.38640 WP_000372529.1.3885 WP_000372529.1.38930 WP_000372529.1.39074 WP_000372529.1.39270 WP_000372529.1.39318 WP_000372529.1.39568 WP_000372529.1.39978 WP_000372529.1.40003 WP_000372529.1.40118 WP_000372529.1.40566 WP_000372529.1.40696 WP_000372529.1.40714 WP_000372529.1.40883 WP_000372529.1.41388 WP_000372529.1.41756 WP_000372529.1.41958 WP_000372529.1.42358 WP_000372529.1.42528 WP_000372529.1.43085 WP_000372529.1.43109 WP_000372529.1.43443 WP_000372529.1.43453 WP_000372529.1.4366 WP_000372529.1.44885 WP_000372529.1.45222 WP_000372529.1.45283 WP_000372529.1.45612 WP_000372529.1.46060 WP_000372529.1.46177 WP_000372529.1.4621 WP_000372529.1.4629 WP_000372529.1.4656 WP_000372529.1.46632 WP_000372529.1.47833 WP_000372529.1.47973 WP_000372529.1.48037 WP_000372529.1.48122 WP_000372529.1.49628 WP_000372529.1.50838 WP_000372529.1.51504 WP_000372529.1.52373 WP_000372529.1.52386 WP_000372529.1.52977 WP_000372529.1.53355 WP_000372529.1.53633 WP_000372529.1.54183 WP_000372529.1.54187 WP_000372529.1.54458 WP_000372529.1.54563 WP_000372529.1.54656 WP_000372529.1.54697 WP_000372529.1.55211 WP_000372529.1.55331 WP_000372529.1.55332 WP_000372529.1.55711 WP_000372529.1.55861 WP_000372529.1.55918 WP_000372529.1.56124 WP_000372529.1.56155 WP_000372529.1.56678 WP_000372529.1.57384 WP_000372529.1.57787 WP_000372529.1.58437 WP_000372529.1.58717 WP_000372529.1.59468 WP_000372529.1.60996 WP_000372529.1.61021 WP_000372529.1.61151 WP_000372529.1.6137 WP_000372529.1.61386 WP_000372529.1.61845 WP_000372529.1.61848 WP_000372529.1.62062 WP_000372529.1.62615 WP_000372529.1.6279 WP_000372529.1.63230 WP_000372529.1.63587 WP_000372529.1.63753 WP_000372529.1.63792 WP_000372529.1.64113 WP_000372529.1.64373 WP_000372529.1.64871 WP_000372529.1.64890 WP_000372529.1.649 WP_000372529.1.6505 WP_000372529.1.65126 WP_000372529.1.65339 WP_000372529.1.65344 WP_000372529.1.65568 WP_000372529.1.65657 WP_000372529.1.65897 WP_000372529.1.663 WP_000372529.1.67121 WP_000372529.1.67515 WP_000372529.1.6759 WP_000372529.1.67613 WP_000372529.1.68458 WP_000372529.1.68508 WP_000372529.1.68660 WP_000372529.1.68712 WP_000372529.1.68729 WP_000372529.1.68835 WP_000372529.1.69557 WP_000372529.1.71283 WP_000372529.1.71360 WP_000372529.1.71565 WP_000372529.1.71959 WP_000372529.1.72071 WP_000372529.1.72595 WP_000372529.1.72628 WP_000372529.1.72646 WP_000372529.1.73359 WP_000372529.1.73462 WP_000372529.1.73675 WP_000372529.1.73710 WP_000372529.1.73939 WP_000372529.1.74011 WP_000372529.1.74033 WP_000372529.1.74260 WP_000372529.1.74308 WP_000372529.1.7485 WP_000372529.1.76093 WP_000372529.1.76264 WP_000372529.1.77944 WP_000372529.1.78343 WP_000372529.1.78379 WP_000372529.1.78535 WP_000372529.1.78866 WP_000372529.1.79173 WP_000372529.1.79418 WP_000372529.1.79469 WP_000372529.1.7968 WP_000372529.1.79841 WP_000372529.1.81241 WP_000372529.1.81381 WP_000372529.1.81500 WP_000372529.1.82603 WP_000372529.1.82869 WP_000372529.1.83319 WP_000372529.1.83635 WP_000372529.1.83731 WP_000372529.1.83956 WP_000372529.1.84821 WP_000372529.1.85232 WP_000372529.1.85400 WP_000372529.1.85921 WP_000372529.1.86546 WP_000372529.1.8655 WP_000372529.1.86631 WP_000372529.1.87336 WP_000372529.1.87681 WP_000372529.1.88343 WP_000372529.1.88509 WP_000372529.1.88719 WP_000372529.1.88840 WP_000372529.1.89498 WP_000372529.1.89645 WP_000372529.1.90213 WP_000372529.1.90312 WP_000372529.1.90319 WP_000372529.1.90361 WP_000372529.1.90603 WP_000372529.1.90942 WP_000372529.1.91129 WP_000372529.1.91858 WP_000372529.1.92116 WP_000372529.1.92344 WP_000372529.1.92355 WP_000372529.1.92850 WP_000372529.1.93096 WP_000372529.1.93361 WP_000372529.1.93404 WP_000372529.1.935 WP_000372529.1.93832 WP_000372529.1.94220 WP_000372529.1.94368 WP_000372529.1.94391 WP_000372529.1.95104 WP_000372529.1.95583 WP_000372529.1.95692 WP_000372529.1.95732 WP_000372529.1.95738 WP_000372529.1.95765 WP_000372529.1.96872 WP_000372529.1.972 WP_000372529.1.97436 WP_000372529.1.97610 WP_000372529.1.97810 WP_000372529.1.97994 WP_000372529.1.98428 WP_000372529.1.98879 WP_000372529.1.98934 WP_000372529.1.99557 WP_000372529.1.99628 WP_000372529.1.99760 gi|480536077|ref|YP_007813986.1| 170187.SP_0292 gi|480534250|ref|YP_007812160.1| gi|15900226|ref|NP_344830.1| gi|480530630|ref|YP_007762834.1| gi|480533430|ref|YP_007765633.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]