SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222152656|ref|YP_002561831.1| from Streptococcus uberis 0140J

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222152656|ref|YP_002561831.1|
Domain Number 1 Region: 1-84
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 5.89e-30
Family Ribosomal L11/L12e N-terminal domain 0.0000601
Further Details:      
 
Domain Number 2 Region: 67-139
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 8.77e-28
Family Ribosomal protein L11, C-terminal domain 0.000044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|222152656|ref|YP_002561831.1|
Sequence length 141
Comment 50S ribosomal protein L11 [Streptococcus uberis 0140J]
Sequence
MAKKVEKLVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGMIIPVVITV
YEDKSFDFITKTPPAAVLLKKAAGVEKGSGTPNKTKVATVTRAQVQEIAETKMPDLNAAN
LESAMRMIEGTARSMGFTITD
Download sequence
Identical sequences B9DRE8
218495.SUB0481 gi|222152656|ref|YP_002561831.1| WP_012658013.1.37397 WP_012658013.1.51754 WP_012658013.1.65710 WP_012658013.1.69183 WP_012658013.1.70036 WP_012658013.1.70882 WP_012658013.1.78160 WP_012658013.1.84361 WP_012658013.1.93969 WP_012658013.1.94620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]