SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|225860328|ref|YP_002741837.1| from Streptococcus pneumoniae Taiwan19F-14

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|225860328|ref|YP_002741837.1|
Domain Number 1 Region: 121-268
Classification Level Classification E-value
Superfamily 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK 1.57e-49
Family 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK 0.00016
Further Details:      
 
Domain Number 2 Region: 2-119
Classification Level Classification E-value
Superfamily Tetrahydrobiopterin biosynthesis enzymes-like 4.09e-28
Family DHN aldolase/epimerase 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|225860328|ref|YP_002741837.1|
Sequence length 270
Comment bifunctional folate synthesis protein [Streptococcus pneumoniae Taiwan19F-14]
Sequence
MDQLQIKDLEMFAYHGLFPSEKELGQKFVVSAILSYDMTKAATDLDLTASVHYGELCQQW
TTWFQETSEDLIETVAYKLVERTFESYPLVQEMKLELKKPWAPVHLSLDTCSVTIHRRKQ
RAFIALGSNMGDKQVNLKQAIDKLRARGIHILKESSVLETEPWGGVEQDSFANQVVEVET
WLPAQDLLETLLAIESELGRVREVHWGPRLIDLDLLFVEDQILYTDDLILPHPYIAERLF
VLESLQEIAPHFIHPILKQPIRNLYDALKK
Download sequence
Identical sequences A0A0U0KYZ2
gi|225860328|ref|YP_002741837.1| gi|556560310|ref|YP_008729656.1| 487213.SPT_0338 WP_000372542.1.1 WP_000372542.1.100011 WP_000372542.1.100039 WP_000372542.1.100054 WP_000372542.1.10020 WP_000372542.1.100201 WP_000372542.1.100203 WP_000372542.1.100353 WP_000372542.1.100572 WP_000372542.1.100634 WP_000372542.1.100715 WP_000372542.1.100848 WP_000372542.1.100897 WP_000372542.1.101045 WP_000372542.1.101116 WP_000372542.1.101215 WP_000372542.1.10123 WP_000372542.1.101455 WP_000372542.1.101482 WP_000372542.1.101483 WP_000372542.1.101494 WP_000372542.1.101746 WP_000372542.1.10175 WP_000372542.1.101790 WP_000372542.1.101801 WP_000372542.1.101876 WP_000372542.1.10192 WP_000372542.1.101946 WP_000372542.1.1020 WP_000372542.1.102004 WP_000372542.1.10316 WP_000372542.1.10367 WP_000372542.1.10437 WP_000372542.1.10494 WP_000372542.1.10807 WP_000372542.1.10828 WP_000372542.1.10937 WP_000372542.1.11096 WP_000372542.1.11243 WP_000372542.1.11297 WP_000372542.1.11517 WP_000372542.1.11573 WP_000372542.1.11842 WP_000372542.1.11931 WP_000372542.1.12062 WP_000372542.1.12084 WP_000372542.1.12339 WP_000372542.1.12404 WP_000372542.1.12429 WP_000372542.1.12489 WP_000372542.1.12583 WP_000372542.1.1288 WP_000372542.1.12928 WP_000372542.1.12942 WP_000372542.1.12985 WP_000372542.1.1303 WP_000372542.1.13035 WP_000372542.1.13058 WP_000372542.1.13067 WP_000372542.1.13123 WP_000372542.1.13245 WP_000372542.1.1328 WP_000372542.1.13327 WP_000372542.1.13410 WP_000372542.1.13455 WP_000372542.1.13604 WP_000372542.1.13606 WP_000372542.1.13682 WP_000372542.1.13745 WP_000372542.1.13830 WP_000372542.1.13873 WP_000372542.1.13903 WP_000372542.1.13960 WP_000372542.1.14002 WP_000372542.1.14077 WP_000372542.1.14131 WP_000372542.1.14206 WP_000372542.1.14254 WP_000372542.1.14294 WP_000372542.1.14409 WP_000372542.1.14440 WP_000372542.1.145 WP_000372542.1.14534 WP_000372542.1.14578 WP_000372542.1.14663 WP_000372542.1.14779 WP_000372542.1.15162 WP_000372542.1.15254 WP_000372542.1.1549 WP_000372542.1.15588 WP_000372542.1.15648 WP_000372542.1.15661 WP_000372542.1.1584 WP_000372542.1.15955 WP_000372542.1.15965 WP_000372542.1.15968 WP_000372542.1.16056 WP_000372542.1.16064 WP_000372542.1.16181 WP_000372542.1.16282 WP_000372542.1.16306 WP_000372542.1.16336 WP_000372542.1.16379 WP_000372542.1.16385 WP_000372542.1.16437 WP_000372542.1.16527 WP_000372542.1.16543 WP_000372542.1.16550 WP_000372542.1.17045 WP_000372542.1.17091 WP_000372542.1.17163 WP_000372542.1.17220 WP_000372542.1.1724 WP_000372542.1.17355 WP_000372542.1.17537 WP_000372542.1.17562 WP_000372542.1.17691 WP_000372542.1.17692 WP_000372542.1.17858 WP_000372542.1.17917 WP_000372542.1.17933 WP_000372542.1.17954 WP_000372542.1.180 WP_000372542.1.18081 WP_000372542.1.18233 WP_000372542.1.18361 WP_000372542.1.1839 WP_000372542.1.184 WP_000372542.1.18449 WP_000372542.1.18457 WP_000372542.1.18634 WP_000372542.1.18920 WP_000372542.1.19124 WP_000372542.1.19237 WP_000372542.1.19267 WP_000372542.1.1956 WP_000372542.1.19603 WP_000372542.1.19677 WP_000372542.1.19719 WP_000372542.1.19837 WP_000372542.1.19961 WP_000372542.1.19965 WP_000372542.1.19998 WP_000372542.1.20108 WP_000372542.1.2019 WP_000372542.1.20241 WP_000372542.1.20250 WP_000372542.1.203 WP_000372542.1.20363 WP_000372542.1.20374 WP_000372542.1.20396 WP_000372542.1.20681 WP_000372542.1.20693 WP_000372542.1.207 WP_000372542.1.20719 WP_000372542.1.20766 WP_000372542.1.20892 WP_000372542.1.20969 WP_000372542.1.21230 WP_000372542.1.21297 WP_000372542.1.213 WP_000372542.1.21381 WP_000372542.1.21472 WP_000372542.1.21495 WP_000372542.1.21610 WP_000372542.1.21675 WP_000372542.1.21684 WP_000372542.1.21806 WP_000372542.1.21949 WP_000372542.1.21957 WP_000372542.1.2197 WP_000372542.1.22382 WP_000372542.1.22422 WP_000372542.1.22436 WP_000372542.1.22439 WP_000372542.1.22505 WP_000372542.1.22513 WP_000372542.1.22637 WP_000372542.1.22643 WP_000372542.1.22700 WP_000372542.1.22717 WP_000372542.1.22720 WP_000372542.1.2297 WP_000372542.1.2310 WP_000372542.1.23256 WP_000372542.1.23313 WP_000372542.1.23597 WP_000372542.1.23703 WP_000372542.1.23847 WP_000372542.1.23912 WP_000372542.1.24252 WP_000372542.1.24281 WP_000372542.1.24288 WP_000372542.1.24379 WP_000372542.1.24467 WP_000372542.1.24552 WP_000372542.1.2459 WP_000372542.1.24649 WP_000372542.1.24677 WP_000372542.1.24678 WP_000372542.1.24742 WP_000372542.1.24812 WP_000372542.1.24852 WP_000372542.1.24861 WP_000372542.1.24943 WP_000372542.1.25153 WP_000372542.1.25298 WP_000372542.1.25351 WP_000372542.1.2538 WP_000372542.1.25432 WP_000372542.1.25442 WP_000372542.1.2548 WP_000372542.1.25845 WP_000372542.1.25880 WP_000372542.1.25905 WP_000372542.1.25909 WP_000372542.1.26062 WP_000372542.1.26112 WP_000372542.1.26180 WP_000372542.1.26208 WP_000372542.1.26280 WP_000372542.1.2647 WP_000372542.1.26518 WP_000372542.1.26566 WP_000372542.1.26578 WP_000372542.1.26983 WP_000372542.1.27047 WP_000372542.1.27149 WP_000372542.1.27203 WP_000372542.1.2724 WP_000372542.1.2735 WP_000372542.1.27478 WP_000372542.1.27514 WP_000372542.1.27653 WP_000372542.1.27686 WP_000372542.1.27984 WP_000372542.1.28050 WP_000372542.1.28164 WP_000372542.1.28228 WP_000372542.1.28231 WP_000372542.1.28522 WP_000372542.1.28667 WP_000372542.1.28790 WP_000372542.1.2882 WP_000372542.1.28836 WP_000372542.1.2888 WP_000372542.1.29041 WP_000372542.1.29069 WP_000372542.1.29098 WP_000372542.1.292 WP_000372542.1.29222 WP_000372542.1.29266 WP_000372542.1.29311 WP_000372542.1.29337 WP_000372542.1.295 WP_000372542.1.29517 WP_000372542.1.29549 WP_000372542.1.29929 WP_000372542.1.29980 WP_000372542.1.3008 WP_000372542.1.30199 WP_000372542.1.30205 WP_000372542.1.30297 WP_000372542.1.30316 WP_000372542.1.30370 WP_000372542.1.30387 WP_000372542.1.3061 WP_000372542.1.30647 WP_000372542.1.30705 WP_000372542.1.31164 WP_000372542.1.31169 WP_000372542.1.31394 WP_000372542.1.31420 WP_000372542.1.31464 WP_000372542.1.31528 WP_000372542.1.3155 WP_000372542.1.31735 WP_000372542.1.31859 WP_000372542.1.32097 WP_000372542.1.3221 WP_000372542.1.32389 WP_000372542.1.32391 WP_000372542.1.32444 WP_000372542.1.32462 WP_000372542.1.32567 WP_000372542.1.32667 WP_000372542.1.32807 WP_000372542.1.32808 WP_000372542.1.32877 WP_000372542.1.32923 WP_000372542.1.33001 WP_000372542.1.33159 WP_000372542.1.33181 WP_000372542.1.33233 WP_000372542.1.33312 WP_000372542.1.33334 WP_000372542.1.33433 WP_000372542.1.33511 WP_000372542.1.33527 WP_000372542.1.33570 WP_000372542.1.33710 WP_000372542.1.3384 WP_000372542.1.33859 WP_000372542.1.33897 WP_000372542.1.33953 WP_000372542.1.34028 WP_000372542.1.3409 WP_000372542.1.34171 WP_000372542.1.34335 WP_000372542.1.3437 WP_000372542.1.34378 WP_000372542.1.34519 WP_000372542.1.3464 WP_000372542.1.34674 WP_000372542.1.34787 WP_000372542.1.3494 WP_000372542.1.34995 WP_000372542.1.3502 WP_000372542.1.35103 WP_000372542.1.3532 WP_000372542.1.35541 WP_000372542.1.35685 WP_000372542.1.35743 WP_000372542.1.35834 WP_000372542.1.35957 WP_000372542.1.3596 WP_000372542.1.35974 WP_000372542.1.35981 WP_000372542.1.36002 WP_000372542.1.36109 WP_000372542.1.36124 WP_000372542.1.3616 WP_000372542.1.36230 WP_000372542.1.36272 WP_000372542.1.36300 WP_000372542.1.36382 WP_000372542.1.36479 WP_000372542.1.36538 WP_000372542.1.36750 WP_000372542.1.36972 WP_000372542.1.36993 WP_000372542.1.37062 WP_000372542.1.37138 WP_000372542.1.37142 WP_000372542.1.37154 WP_000372542.1.37156 WP_000372542.1.37294 WP_000372542.1.37457 WP_000372542.1.37511 WP_000372542.1.37599 WP_000372542.1.37714 WP_000372542.1.37767 WP_000372542.1.37837 WP_000372542.1.37854 WP_000372542.1.37947 WP_000372542.1.38283 WP_000372542.1.3830 WP_000372542.1.38542 WP_000372542.1.38543 WP_000372542.1.38643 WP_000372542.1.38647 WP_000372542.1.387 WP_000372542.1.38723 WP_000372542.1.38796 WP_000372542.1.38805 WP_000372542.1.38906 WP_000372542.1.3897 WP_000372542.1.39076 WP_000372542.1.39151 WP_000372542.1.39192 WP_000372542.1.39320 WP_000372542.1.39454 WP_000372542.1.39511 WP_000372542.1.39569 WP_000372542.1.39865 WP_000372542.1.39964 WP_000372542.1.40023 WP_000372542.1.40128 WP_000372542.1.40239 WP_000372542.1.40274 WP_000372542.1.40290 WP_000372542.1.40333 WP_000372542.1.4044 WP_000372542.1.40526 WP_000372542.1.40642 WP_000372542.1.4073 WP_000372542.1.40739 WP_000372542.1.40887 WP_000372542.1.40928 WP_000372542.1.40958 WP_000372542.1.40971 WP_000372542.1.40977 WP_000372542.1.41010 WP_000372542.1.41019 WP_000372542.1.41071 WP_000372542.1.4117 WP_000372542.1.41268 WP_000372542.1.41309 WP_000372542.1.41319 WP_000372542.1.4133 WP_000372542.1.41366 WP_000372542.1.4152 WP_000372542.1.41523 WP_000372542.1.41527 WP_000372542.1.41594 WP_000372542.1.41801 WP_000372542.1.41811 WP_000372542.1.41858 WP_000372542.1.41927 WP_000372542.1.42086 WP_000372542.1.42106 WP_000372542.1.42234 WP_000372542.1.42245 WP_000372542.1.42266 WP_000372542.1.42291 WP_000372542.1.42337 WP_000372542.1.4238 WP_000372542.1.42386 WP_000372542.1.4252 WP_000372542.1.42654 WP_000372542.1.42960 WP_000372542.1.43066 WP_000372542.1.4307 WP_000372542.1.43192 WP_000372542.1.43329 WP_000372542.1.43377 WP_000372542.1.4340 WP_000372542.1.43464 WP_000372542.1.43529 WP_000372542.1.43661 WP_000372542.1.43906 WP_000372542.1.44293 WP_000372542.1.44295 WP_000372542.1.44303 WP_000372542.1.44328 WP_000372542.1.44473 WP_000372542.1.44683 WP_000372542.1.45021 WP_000372542.1.45082 WP_000372542.1.45087 WP_000372542.1.45148 WP_000372542.1.45179 WP_000372542.1.45196 WP_000372542.1.45378 WP_000372542.1.4543 WP_000372542.1.45572 WP_000372542.1.45746 WP_000372542.1.45810 WP_000372542.1.45843 WP_000372542.1.45981 WP_000372542.1.46012 WP_000372542.1.46044 WP_000372542.1.46166 WP_000372542.1.46191 WP_000372542.1.46495 WP_000372542.1.46560 WP_000372542.1.46562 WP_000372542.1.4659 WP_000372542.1.46598 WP_000372542.1.46656 WP_000372542.1.4667 WP_000372542.1.46695 WP_000372542.1.46709 WP_000372542.1.46721 WP_000372542.1.46831 WP_000372542.1.46858 WP_000372542.1.46871 WP_000372542.1.47017 WP_000372542.1.47056 WP_000372542.1.47183 WP_000372542.1.47395 WP_000372542.1.47490 WP_000372542.1.47569 WP_000372542.1.47620 WP_000372542.1.47635 WP_000372542.1.47824 WP_000372542.1.47860 WP_000372542.1.4790 WP_000372542.1.47905 WP_000372542.1.48137 WP_000372542.1.48296 WP_000372542.1.48381 WP_000372542.1.48384 WP_000372542.1.48489 WP_000372542.1.48503 WP_000372542.1.48730 WP_000372542.1.48780 WP_000372542.1.48796 WP_000372542.1.48892 WP_000372542.1.49000 WP_000372542.1.49181 WP_000372542.1.49331 WP_000372542.1.49389 WP_000372542.1.49540 WP_000372542.1.4957 WP_000372542.1.4960 WP_000372542.1.49845 WP_000372542.1.49909 WP_000372542.1.50031 WP_000372542.1.50107 WP_000372542.1.50169 WP_000372542.1.50327 WP_000372542.1.50383 WP_000372542.1.50560 WP_000372542.1.50572 WP_000372542.1.50613 WP_000372542.1.50764 WP_000372542.1.50843 WP_000372542.1.50930 WP_000372542.1.51041 WP_000372542.1.51080 WP_000372542.1.51110 WP_000372542.1.51113 WP_000372542.1.5112 WP_000372542.1.51210 WP_000372542.1.51383 WP_000372542.1.51511 WP_000372542.1.51602 WP_000372542.1.51750 WP_000372542.1.51762 WP_000372542.1.51825 WP_000372542.1.51947 WP_000372542.1.51962 WP_000372542.1.52026 WP_000372542.1.52143 WP_000372542.1.5242 WP_000372542.1.52709 WP_000372542.1.52783 WP_000372542.1.52834 WP_000372542.1.52896 WP_000372542.1.52921 WP_000372542.1.52940 WP_000372542.1.52975 WP_000372542.1.53039 WP_000372542.1.53129 WP_000372542.1.53476 WP_000372542.1.5364 WP_000372542.1.53673 WP_000372542.1.53735 WP_000372542.1.53744 WP_000372542.1.5377 WP_000372542.1.5411 WP_000372542.1.54231 WP_000372542.1.54303 WP_000372542.1.54374 WP_000372542.1.54412 WP_000372542.1.5442 WP_000372542.1.54433 WP_000372542.1.54501 WP_000372542.1.54570 WP_000372542.1.54597 WP_000372542.1.5477 WP_000372542.1.54793 WP_000372542.1.54907 WP_000372542.1.55087 WP_000372542.1.55120 WP_000372542.1.55183 WP_000372542.1.55281 WP_000372542.1.55312 WP_000372542.1.55337 WP_000372542.1.55395 WP_000372542.1.55411 WP_000372542.1.55474 WP_000372542.1.55561 WP_000372542.1.55816 WP_000372542.1.55889 WP_000372542.1.56283 WP_000372542.1.56294 WP_000372542.1.56326 WP_000372542.1.56472 WP_000372542.1.56519 WP_000372542.1.56546 WP_000372542.1.56607 WP_000372542.1.56734 WP_000372542.1.56739 WP_000372542.1.56774 WP_000372542.1.56790 WP_000372542.1.56805 WP_000372542.1.56913 WP_000372542.1.56940 WP_000372542.1.57013 WP_000372542.1.57044 WP_000372542.1.5709 WP_000372542.1.57118 WP_000372542.1.57176 WP_000372542.1.57192 WP_000372542.1.57303 WP_000372542.1.57419 WP_000372542.1.57446 WP_000372542.1.57516 WP_000372542.1.57698 WP_000372542.1.57712 WP_000372542.1.57866 WP_000372542.1.57897 WP_000372542.1.58196 WP_000372542.1.58378 WP_000372542.1.58452 WP_000372542.1.58554 WP_000372542.1.58591 WP_000372542.1.58613 WP_000372542.1.58615 WP_000372542.1.59201 WP_000372542.1.59208 WP_000372542.1.59307 WP_000372542.1.59361 WP_000372542.1.5939 WP_000372542.1.59527 WP_000372542.1.59607 WP_000372542.1.59642 WP_000372542.1.59666 WP_000372542.1.59718 WP_000372542.1.5976 WP_000372542.1.59774 WP_000372542.1.59935 WP_000372542.1.59951 WP_000372542.1.60026 WP_000372542.1.60032 WP_000372542.1.60064 WP_000372542.1.60248 WP_000372542.1.60281 WP_000372542.1.60423 WP_000372542.1.6044 WP_000372542.1.61050 WP_000372542.1.61236 WP_000372542.1.61300 WP_000372542.1.61444 WP_000372542.1.61499 WP_000372542.1.61647 WP_000372542.1.61651 WP_000372542.1.6174 WP_000372542.1.61785 WP_000372542.1.61863 WP_000372542.1.62129 WP_000372542.1.62173 WP_000372542.1.62316 WP_000372542.1.62397 WP_000372542.1.62432 WP_000372542.1.62521 WP_000372542.1.62528 WP_000372542.1.62638 WP_000372542.1.62643 WP_000372542.1.62775 WP_000372542.1.62833 WP_000372542.1.63093 WP_000372542.1.63156 WP_000372542.1.6316 WP_000372542.1.63225 WP_000372542.1.63311 WP_000372542.1.63425 WP_000372542.1.63430 WP_000372542.1.63724 WP_000372542.1.63908 WP_000372542.1.63943 WP_000372542.1.64067 WP_000372542.1.64167 WP_000372542.1.64267 WP_000372542.1.64322 WP_000372542.1.64399 WP_000372542.1.64423 WP_000372542.1.64449 WP_000372542.1.64481 WP_000372542.1.64518 WP_000372542.1.64698 WP_000372542.1.64723 WP_000372542.1.64733 WP_000372542.1.64785 WP_000372542.1.64816 WP_000372542.1.64857 WP_000372542.1.64867 WP_000372542.1.64882 WP_000372542.1.65331 WP_000372542.1.65336 WP_000372542.1.65380 WP_000372542.1.65431 WP_000372542.1.65452 WP_000372542.1.65536 WP_000372542.1.65574 WP_000372542.1.65702 WP_000372542.1.65743 WP_000372542.1.65748 WP_000372542.1.65799 WP_000372542.1.65916 WP_000372542.1.65941 WP_000372542.1.65944 WP_000372542.1.65982 WP_000372542.1.66003 WP_000372542.1.66135 WP_000372542.1.66307 WP_000372542.1.66333 WP_000372542.1.66356 WP_000372542.1.66399 WP_000372542.1.66569 WP_000372542.1.66654 WP_000372542.1.66734 WP_000372542.1.66781 WP_000372542.1.6694 WP_000372542.1.66964 WP_000372542.1.67080 WP_000372542.1.67096 WP_000372542.1.67302 WP_000372542.1.67349 WP_000372542.1.67432 WP_000372542.1.67594 WP_000372542.1.67639 WP_000372542.1.67648 WP_000372542.1.6773 WP_000372542.1.67885 WP_000372542.1.68048 WP_000372542.1.68061 WP_000372542.1.681 WP_000372542.1.68103 WP_000372542.1.68323 WP_000372542.1.68363 WP_000372542.1.68393 WP_000372542.1.68531 WP_000372542.1.68544 WP_000372542.1.68595 WP_000372542.1.68596 WP_000372542.1.68644 WP_000372542.1.68721 WP_000372542.1.68812 WP_000372542.1.68939 WP_000372542.1.68960 WP_000372542.1.69000 WP_000372542.1.69097 WP_000372542.1.69407 WP_000372542.1.69482 WP_000372542.1.69504 WP_000372542.1.69653 WP_000372542.1.69946 WP_000372542.1.70119 WP_000372542.1.70223 WP_000372542.1.70233 WP_000372542.1.70302 WP_000372542.1.70421 WP_000372542.1.70513 WP_000372542.1.70528 WP_000372542.1.70674 WP_000372542.1.70828 WP_000372542.1.70931 WP_000372542.1.70951 WP_000372542.1.70961 WP_000372542.1.71078 WP_000372542.1.71084 WP_000372542.1.71093 WP_000372542.1.71177 WP_000372542.1.71178 WP_000372542.1.71277 WP_000372542.1.71460 WP_000372542.1.71534 WP_000372542.1.71574 WP_000372542.1.71787 WP_000372542.1.71824 WP_000372542.1.72251 WP_000372542.1.72321 WP_000372542.1.72390 WP_000372542.1.7271 WP_000372542.1.72855 WP_000372542.1.72900 WP_000372542.1.72942 WP_000372542.1.73100 WP_000372542.1.73288 WP_000372542.1.73356 WP_000372542.1.73665 WP_000372542.1.73725 WP_000372542.1.73903 WP_000372542.1.74015 WP_000372542.1.74075 WP_000372542.1.74239 WP_000372542.1.74250 WP_000372542.1.74293 WP_000372542.1.74363 WP_000372542.1.74399 WP_000372542.1.74437 WP_000372542.1.74443 WP_000372542.1.74496 WP_000372542.1.74516 WP_000372542.1.74550 WP_000372542.1.74633 WP_000372542.1.74679 WP_000372542.1.74906 WP_000372542.1.74928 WP_000372542.1.74940 WP_000372542.1.75325 WP_000372542.1.75335 WP_000372542.1.75401 WP_000372542.1.75584 WP_000372542.1.75586 WP_000372542.1.75601 WP_000372542.1.75857 WP_000372542.1.75876 WP_000372542.1.7591 WP_000372542.1.75982 WP_000372542.1.76051 WP_000372542.1.76091 WP_000372542.1.76303 WP_000372542.1.76439 WP_000372542.1.76675 WP_000372542.1.7678 WP_000372542.1.76857 WP_000372542.1.7713 WP_000372542.1.77195 WP_000372542.1.7725 WP_000372542.1.77468 WP_000372542.1.77483 WP_000372542.1.78078 WP_000372542.1.78108 WP_000372542.1.7813 WP_000372542.1.7828 WP_000372542.1.78395 WP_000372542.1.78397 WP_000372542.1.78444 WP_000372542.1.78541 WP_000372542.1.78546 WP_000372542.1.78656 WP_000372542.1.78710 WP_000372542.1.78733 WP_000372542.1.78870 WP_000372542.1.79187 WP_000372542.1.79316 WP_000372542.1.7959 WP_000372542.1.79940 WP_000372542.1.80093 WP_000372542.1.80190 WP_000372542.1.80256 WP_000372542.1.80314 WP_000372542.1.80357 WP_000372542.1.80467 WP_000372542.1.80557 WP_000372542.1.80596 WP_000372542.1.80619 WP_000372542.1.80672 WP_000372542.1.80700 WP_000372542.1.80919 WP_000372542.1.81314 WP_000372542.1.81492 WP_000372542.1.81530 WP_000372542.1.81585 WP_000372542.1.81616 WP_000372542.1.81703 WP_000372542.1.81707 WP_000372542.1.81729 WP_000372542.1.81769 WP_000372542.1.81857 WP_000372542.1.81962 WP_000372542.1.81967 WP_000372542.1.82005 WP_000372542.1.82029 WP_000372542.1.82195 WP_000372542.1.82213 WP_000372542.1.82255 WP_000372542.1.82298 WP_000372542.1.82353 WP_000372542.1.82382 WP_000372542.1.82386 WP_000372542.1.82392 WP_000372542.1.8248 WP_000372542.1.82557 WP_000372542.1.82563 WP_000372542.1.82736 WP_000372542.1.8275 WP_000372542.1.8276 WP_000372542.1.82783 WP_000372542.1.83115 WP_000372542.1.8315 WP_000372542.1.83199 WP_000372542.1.83219 WP_000372542.1.83231 WP_000372542.1.83471 WP_000372542.1.83719 WP_000372542.1.83732 WP_000372542.1.83843 WP_000372542.1.84056 WP_000372542.1.84080 WP_000372542.1.84092 WP_000372542.1.84292 WP_000372542.1.84363 WP_000372542.1.84477 WP_000372542.1.84552 WP_000372542.1.846 WP_000372542.1.84613 WP_000372542.1.84636 WP_000372542.1.84658 WP_000372542.1.84669 WP_000372542.1.84724 WP_000372542.1.84746 WP_000372542.1.84858 WP_000372542.1.85250 WP_000372542.1.85496 WP_000372542.1.85522 WP_000372542.1.85552 WP_000372542.1.85624 WP_000372542.1.85750 WP_000372542.1.85861 WP_000372542.1.85869 WP_000372542.1.86013 WP_000372542.1.8618 WP_000372542.1.86330 WP_000372542.1.86346 WP_000372542.1.86456 WP_000372542.1.86496 WP_000372542.1.86702 WP_000372542.1.8674 WP_000372542.1.86784 WP_000372542.1.86798 WP_000372542.1.86875 WP_000372542.1.87084 WP_000372542.1.87094 WP_000372542.1.8747 WP_000372542.1.87521 WP_000372542.1.87548 WP_000372542.1.87799 WP_000372542.1.87833 WP_000372542.1.88103 WP_000372542.1.88113 WP_000372542.1.88196 WP_000372542.1.88203 WP_000372542.1.8823 WP_000372542.1.88365 WP_000372542.1.88387 WP_000372542.1.8858 WP_000372542.1.88716 WP_000372542.1.8876 WP_000372542.1.89282 WP_000372542.1.89310 WP_000372542.1.89442 WP_000372542.1.89585 WP_000372542.1.89624 WP_000372542.1.89658 WP_000372542.1.89864 WP_000372542.1.89881 WP_000372542.1.89942 WP_000372542.1.90001 WP_000372542.1.90163 WP_000372542.1.90261 WP_000372542.1.90356 WP_000372542.1.90397 WP_000372542.1.90482 WP_000372542.1.90539 WP_000372542.1.90583 WP_000372542.1.90663 WP_000372542.1.90731 WP_000372542.1.90733 WP_000372542.1.90776 WP_000372542.1.90882 WP_000372542.1.90927 WP_000372542.1.90936 WP_000372542.1.90980 WP_000372542.1.91125 WP_000372542.1.91131 WP_000372542.1.91149 WP_000372542.1.91172 WP_000372542.1.91271 WP_000372542.1.91276 WP_000372542.1.91321 WP_000372542.1.91375 WP_000372542.1.91383 WP_000372542.1.91733 WP_000372542.1.91924 WP_000372542.1.92010 WP_000372542.1.92045 WP_000372542.1.92086 WP_000372542.1.92245 WP_000372542.1.9225 WP_000372542.1.92400 WP_000372542.1.92564 WP_000372542.1.92732 WP_000372542.1.92755 WP_000372542.1.93496 WP_000372542.1.93506 WP_000372542.1.93616 WP_000372542.1.93835 WP_000372542.1.93992 WP_000372542.1.94061 WP_000372542.1.94159 WP_000372542.1.94192 WP_000372542.1.94260 WP_000372542.1.94274 WP_000372542.1.94509 WP_000372542.1.9458 WP_000372542.1.94708 WP_000372542.1.9483 WP_000372542.1.95013 WP_000372542.1.95098 WP_000372542.1.95251 WP_000372542.1.95264 WP_000372542.1.953 WP_000372542.1.95479 WP_000372542.1.95532 WP_000372542.1.95621 WP_000372542.1.95769 WP_000372542.1.95956 WP_000372542.1.95992 WP_000372542.1.96012 WP_000372542.1.96048 WP_000372542.1.96081 WP_000372542.1.96096 WP_000372542.1.96109 WP_000372542.1.9611 WP_000372542.1.9612 WP_000372542.1.96205 WP_000372542.1.96564 WP_000372542.1.9662 WP_000372542.1.967 WP_000372542.1.96749 WP_000372542.1.96785 WP_000372542.1.96791 WP_000372542.1.96875 WP_000372542.1.97046 WP_000372542.1.97070 WP_000372542.1.97159 WP_000372542.1.97265 WP_000372542.1.9727 WP_000372542.1.97410 WP_000372542.1.97482 WP_000372542.1.97804 WP_000372542.1.97859 WP_000372542.1.97880 WP_000372542.1.98094 WP_000372542.1.98168 WP_000372542.1.98259 WP_000372542.1.98273 WP_000372542.1.98288 WP_000372542.1.983 WP_000372542.1.98388 WP_000372542.1.98589 WP_000372542.1.98828 WP_000372542.1.98859 WP_000372542.1.99202 WP_000372542.1.99301 WP_000372542.1.99313 WP_000372542.1.99358 WP_000372542.1.99364 WP_000372542.1.99547 WP_000372542.1.99600 WP_000372542.1.99669 WP_000372542.1.99674 WP_000372542.1.99853 gi|387787500|ref|YP_006252568.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]