SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|239908936|ref|YP_002955678.1| from Desulfovibrio magneticus RS-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|239908936|ref|YP_002955678.1|
Domain Number 1 Region: 473-581
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000294
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|239908936|ref|YP_002955678.1|
Sequence length 643
Comment sulfate transporter family protein [Desulfovibrio magneticus RS-1]
Sequence
MVVTIHPSRRRPVEHCDLPRRPSRFEPLLRLLPRLFPFLSWWPRVGRRTLTADLWAGLTG
AVIVLPQGVAFAAIAGLPPQYGLYAAMVPVIVAALYGSSWHLISGPTTAISLVVFANVSQ
LAPPGSPDYIRLVLALTVLAGLVQFGLGLARLGGVVNFVSHSVVTGFTAGAAILIATSQL
GHFFGVTLPRGGSFLETWLAFFQQLPAVNGHVALIAGATLLVALVLRRLWPRCPALLLSL
IAGSLLCHVLNGAGHGAKLVGALPASLPPLSLPEIDLDTFRVLFPGALAVAMLGLAEAVS
IARAVAVRSEQHIDNSQEFIGQGLANIAGGFFSGYASSGSFTRTGVNFDAGAKTPLAAVF
SAVLLALVVLLVAPATAYLPIAAMAGVIVLVAAGLVNAKAIRHILRTDRSEAGVLAATFL
STLFVGLEFAIYAGVMLSLLLYLRRTSHPHFITLAPDPASSRHALVNVRRKKLAECPQLK
ILRLDGSIFFGAVNHIAEELHRIVEKSPEQCHILIIGSGINFIDAGGCHMLFHEAGAMKL
SGREIFFCSLKGEVMELLTRGGCLARIGAENVFRDKESAIAGIVARLDPERCACCPSRVF
AECAGRPGGWAEGLAAAGLAELGDGPALAEGDDDENDDAPEEG
Download sequence
Identical sequences C4XQQ8
573370.DMR_43010 gi|239908936|ref|YP_002955678.1| WP_015862912.1.87776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]